Typing tool

Complete norovirus genomes

FJ537138  GII.4
 GII.P39

Length: 7,580 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       FJ537138                7580 bp    RNA     linear   VRL 02-NOV-2009
DEFINITION  Norovirus Hu/GII.4/CHDC4871/1977/US, complete genome.
ACCESSION   FJ537138
VERSION     FJ537138.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/CHDC4871/1977/US
  ORGANISM  Norovirus Hu/GII.4/CHDC4871/1977/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7580)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Evolutionary dynamics of GII.4 noroviruses over a 34-year period
  JOURNAL   J. Virol. 83 (22), 11890-11901 (2009)
   PUBMED   19759138
REFERENCE   2  (bases 1 to 7580)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2008) Laboratory of Infectious Diseases,
            Epidemiology Section, Norovirus Gastroenteritis Unit, National
            Institute of Allergy and Infectious Diseases, National Institutes
            of Health, 50 South Drive, BLD 50, Room 6316, Bethesda, MD 20892,
            USA
FEATURES             Location/Qualifiers
     source          1..7580
                     /organism="Norovirus Hu/GII.4/CHDC4871/1977/US"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/CHDC4871/1977/US"
                     /host="Homo sapiens"
                     /db_xref="taxon:660659"
                     /country="USA"
                     /collection_date="1977"
                     /note="genotype: GII.4"
     CDS             5..5104
                     /note="ORF-1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ACT76150.1"
                     /translation="MKMASNDASAAAAANGNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKKVPPPPPNGEDEPVVSYNAKNGVSGLPELSTVRQPD
                     ENNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEASELAMVRSIEDAVLDLEAIENNHLTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKKIATTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLVLAPQGGFDKNGNTPHGKGVMKTLTIGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGGQLKGVRTM
                     PELKQALKNISIKKCQIVYGGSTYTLESDGKGSVRVDKVQSATVQTNNELAGALHHLR
                     CARVRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQLEDTEEATGKDGC
                     PKPKDDEEFVVSSDDIKVEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGTQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRIKGGPSLQQVMRDQLKPFTEP
                     RGKQPKPSVLEAAKRTIINVLEQTIDPPQKWTFAQACASLDKTTSSGHPHHIRKNECW
                     NGDSFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAILAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKMDPEKLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPTQLMSLLGEAALHGPAFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6704
                     /note="structural protein; ORF-2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ACT76151.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQAHDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDG
                     DHHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVLHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6704..7510
                     /note="structural protein; ORF-3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ACT76152.1"
                     /translation="MAGPFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATQKLQQGLMKVKQAVLLEGGFSTTDAARGAIN
                     APMTKALDWSGTRYWAPDARVTTYNAGRFSTPQPLGALPGRTNPRVPAPARSSPSSLS
                     NAPTATSVYSNQTVSTRLGSSAGSGAGVSSLPSTARTRSWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSNQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctaacg gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtact ttctagtatg gctgtcactt ttaaacgagc
      121 ccttggggcg cggcctaagc agccgccccc gagggagata ccacaaagac ccccacgacc
      181 gcccactccg gaattgatca agaaggtccc tccccccccg cccaatgggg aggacgaacc
      241 agtggtttct tacaacgcca agaatggcgt ttctggactg cctgagcttt ccactgtcag
      301 gcaaccagat gagaacaaca cggcatttag tgtcccccca cttaaccaaa gggagaacag
      361 ggatgccaag gagccactaa ctggaacaat cctggagatg tgggatgggg agatctacca
      421 ttatggcttg tatgtggagc gaggcctggt gcttggcgtg cacaaaccgc cagcagctat
      481 tagcctcgct aaggtcgaac tgacaccact ctctttgttt tggagacccg tctacactcc
      541 ccagtacctc atctccccag acacccttag gagattgcat ggtgaatcgt tcccttacac
      601 agcctttgac aacaactgtt atgccttctg ttgctgggtt ctggacctga acgattcatg
      661 gctgagcagg aggatgatac agaggacaac tggcttcttc agaccttacc aggattggaa
      721 caggaagccc cttcccacca tggatgattc caaattaaag aaagtggcca acatattcct
      781 gtgtgctttg tcttcactat tcactagacc tatcaaggac ataataggaa agctaagacc
      841 ccttaacatt ctcaatattt tagcttcatg tgattggacc tttgcaggca tagtggaatc
      901 tctaatcctc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactgggtg actacgaact acaggggcct gaggacctcg cagtagagct
     1021 agtgccagta gtaatggggg gaataggttt ggtgctagga tttaccaaag aaaagattgg
     1081 gaagatgttg tcatctgccg cgtccacact gagggcctgt aaagaccttg gtgcatatgg
     1141 gctggagatc ttaaaactag tcatgaagtg gttcttcccg aagaaagagg aggcgagtga
     1201 gttggccatg gtgagatcca tcgaggacgc ggtgttggac ctcgaagcaa ttgaaaacaa
     1261 ccatttgacc accctgctta aggacaagga cagcctggca acttacatga gaactcttga
     1321 ccttgaggaa gagaaagcca ggaaactctc aaccaagtct gcctcacctg acatcgtggg
     1381 tacaatcaat gctctcctgg cgaggatcgc ggctgcccgt tccctggtac atcgagcaaa
     1441 ggaagaactt tccagcaggc cgagacccgt tgttgtgatg atatcaggaa aaccaggaat
     1501 agggaagacc caccttgcca gagagctggc taagaagatc gcaaccaccc ttacgggaga
     1561 ccagagggtg ggcctcatcc cacgcaatgg tgttgaccac tgggacgcgt acaagggaga
     1621 gagggtcgtc ctctgggatg actacggtat gagtaacccc atccacgatg ccctcaggtt
     1681 acaggagctt gctgacactt gccccctaac actgaattgt gataggattg agaacaaagg
     1741 taaagttttt gacagtgatg ctataattat caccactaac ttggccaacc cagcaccact
     1801 ggactatgtc aactttgagg cgtgctcgag gcgcattgat ttcctcgtgt acgccgaagc
     1861 ccctgatgtt gagaaggcga agcgcgactt cccaggccaa cctgatatgt ggaagaatgc
     1921 cttcagccct gacttctctc acataaagct ggtgctggcc ccgcagggtg gctttgacaa
     1981 gaacggcaac accccacatg ggaagggtgt catgaagacc cttaccatcg gttctctcat
     2041 cgcccgtgct tcaggactcc tccatgaaag gctggatgag tacgagctac aaggcccagc
     2101 cctcacaacc ttcaactttg accgaaacaa agtgctcgct ttcaggcagc ttgctgctga
     2161 aaacaagtac gggttgatgg atacgatgag agttggaggg caactcaagg gcgtcagaac
     2221 catgccagag ctcaagcaag cactcaagaa catctcaatt aagaagtgcc agatagtgta
     2281 tggtggcagc acctacacac ttgaatctga tggcaagggt agtgtgaggg ttgacaaggt
     2341 tcagagtgcc actgtgcaaa ccaacaacga actagccggc gccctgcatc atctcaggtg
     2401 cgccagggtc aggtactatg tcaagtgtgt ccaggaagct ctgtactcca tcattcaaat
     2461 tgcaggggct gcgtttgtca ccacgcgcat tgtcaagcgc atgaacatac aggatctatg
     2521 gtctaagcca caactggagg acacggaaga agccactggc aaagacggat gcccaaaacc
     2581 caaagatgat gaggagtttg ttgtttcatc cgacgacatc aaggttgagg gcaagaaagg
     2641 gaagaacaag actggtcgcg gcaagaagca cacagccttc tcgagtaaag gtctcagtga
     2701 tgaggagtac gacgagtaca aaagaatcag ggaggaaaga aacggcaagt actctataga
     2761 ggaatacctc caagacagag acaagtatta cgaggaggtt gccatcgcca gggcgactga
     2821 agaggatttc tgtgaagagg aagaggccaa gatccgacag agaatcttta gaccaacaag
     2881 gaaacaacgc aaggaggaga gggcttctct cggtctagtc acaggctctg aaatcaggaa
     2941 aagaaaccca gatgacttca aacccaaggg aaagttgtgg gccgatgacg acagaagtgt
     3001 cgattacaac gagaagctca gttttgaagc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggttcg ggttggggtt tctgggtttc ccccagtctg ttcataacat caactcatgt
     3121 tataccccag ggcacacagg agttcttcgg agtgtccatc aagcaaatcc agatacacaa
     3181 atcaggcgaa ttctgccgcc tgaggttccc aaaaccaatc aggaccgatg tgacaggcat
     3241 gatcttagag gagggtgccc ccgaaggcac cgtggccaca ctactcatca agagaccaac
     3301 tggtgagctc atgcctttag cagccaggat gggcactcat gcaaccatga agatccaagg
     3361 tcgcactgtt ggaggccaaa tgggtatgct cctgacaggg tccaatgcca aaagtatgga
     3421 cctgggcacc acacctggcg actgtggttg tccctatatc tacaagagag ggaacgacta
     3481 cgtggtcatc ggggttcata cggctgctgc ccgaggaggg aacactgtca tatgtgccac
     3541 ccagggaagt gaaggtgagg ccacacttga gggcggtgac aacaaaggca cctactgtgg
     3601 cgctccgatc ctaggtccag gaagtgcccc aaagctcagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctacctcg gtggtaagga
     3721 ccccagaatc aagggtggcc cctcactaca acaagttatg agggaccagt tgaaaccatt
     3781 cacggaacca agaggcaaac aaccaaagcc aagtgtgttg gaagctgcca agagaaccat
     3841 cattaacgtc cttgaacaaa caatagaccc acctcagaaa tggacgtttg cgcaagcttg
     3901 cgcgtctctt gacaagacca cctccagtgg tcacccacac cacatacgga agaatgaatg
     3961 ctggaatgga gattccttca caggcaagtt ggcagatcag gcctcaaagg ccaacttgat
     4021 gtttgaggag gggaagaaca tgactccagt ttacacaggt gccctcaagg atgagttggt
     4081 caaaactgac aagatatatg gcaagattaa gaagagactg ctttggggat cagacctggc
     4141 aaccatgatc cggtgtgccc gggcgttcgg gggcctaatg gatgagctca aggcccactg
     4201 tgtcacactt cctgtcagag ttggcatgaa catgaatgag gatggcccca tcatctttga
     4261 aaagcattcc aggtatagat atcactatga tgcagactat tctagatggg actcaacaca
     4321 acaaagagct atattggccg cagccctaga gatcatggtc aaattctccc cagagccaca
     4381 cttagcccag atagttgcag aagaccttct atcccccagc gtgatggacg tgggtgattt
     4441 caagatttca atcaacgagg gcctcccctc tggggtacct tgcacttcac aatggaactc
     4501 tatcgcccac tggctcctca ccctctgtgc tctctctgaa gtcacggatc tctcccctga
     4561 cattgttcag gccaactctc tcttctcttt ctatggtgat gatgaaattg tgagcacaga
     4621 tataaaaatg gacccagaaa aactgacggc aaagctaaag gaatatggac tgaagccaac
     4681 ccgccctgac aagactgaag gacctctaat catttctgag gatctaaatg gtttgacctt
     4741 cctgcgaagg actgtaaccc gcgatccagc tggttggttt ggtaaattgg aacaaagctc
     4801 aatactcagg cagatgtact ggaccagggg ccccaaccat gaggacccat ctgaaacaat
     4861 gataccacat tcccaaaggc ccacgcagtt gatgtctttg ctgggtgagg ctgcactgca
     4921 cggcccagca ttctacagca agatcagtaa actagtcatc acagagttaa aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc gatgttcagg tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcctgtt gttggtgccg ccattgcagc acctgtagca ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tgtcccctag aaacgctcca ggtgagatac tatggagcgc gcccttgggc cctgatttga
     5341 acccctatct ttctcacctg tccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aagtaatcct cgcagggaac gcgttcactg ccgggaaagt catatttgca gcagttccac
     5461 caaattttcc aactgaaggt ctaagcccca gccaggttac tatgttcccc catataattg
     5521 tagatgttag gcaactggaa cctgtattga tccccctacc tgatgttagg aataatttct
     5581 atcattataa tcaagcacat gattctaccc taaaattgat agcaatgttg tatacaccac
     5641 tcagagctaa taatgccgga gatgatgtct ttacagtctc ttgtcgagtc ctcacgagac
     5701 catcccccga ttttgatttt atattcctgg tgccacccac agttgaatca agaactaaac
     5761 catttactgt cccaatctta actgttgagg aaatgtccaa ttcaagattc cccattcctt
     5821 tggaaaagct gtacacgggt cctagcagtg cttttgttgt ccaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacta ctcagctgtc agctgtcaat atctgcaact
     5941 tcagggggga tgtcacccgt gttgggatca gccatgatta tacaatgaat ttggtgtccc
     6001 aaaattggaa taattatgac ccaacagaag aaattccagc tcccctggga acgccagact
     6061 ttgtgggaaa gatccaaggt ttgctcaccc aaaccacaag agcggacggt tcgacccgcg
     6121 cccacaaagc tacagtgagc actgggagtg tccacttcac tccaaagctg ggtagtgttc
     6181 aattcaccac cgatacgaac aatgatttcc aaactggcca aaacacaaaa tttaccccag
     6241 ttggtgtcat ccaagacggt gatcaccatc agaatgaacc ccaacaatgg gtactcccaa
     6301 attactcagg cacatctggt cacaatgtgc atctggcccc tgccgttgcc cccactttcc
     6361 cgggtgagca gcttcttttc tttaggtcca ctatgcccgg gtgtagcggg taccccaaca
     6421 tgaatttgga ttgcctactc ccccaggagt gggtgctgca cttttaccag gaagcagccc
     6481 cagcacaatc cgatgtggct ctgttgagat ttgtgaatcc agacacaggt agggttctgt
     6541 ttgagtgcaa actccataaa tcaggctata tcacagtggc tcacaccggc ccgtatgatt
     6601 tggttatccc ccccaatggt tacttcagat ttgattcttg ggtcaaccag ttctacacac
     6661 tcgcccccat gggaaatgga acggggcgca ggcgtgcatt ataatggctg gacctttctt
     6721 tgctggattg gcatctgatg tcctcggttc cggacttggt tctctaatca atgctggagc
     6781 tggagccatc aatcaaaaag ttgaatttga aaacaataga aaattacaac aagcttcttt
     6841 tcaattcagt agtaatctgc aacaggcttc cttccaacat gataaggaga tgctccaagc
     6901 acaaattgag gctactcaaa aattgcaaca aggtttgatg aaggttaaac aggcggtgct
     6961 cttagagggt gggttttcca caacagatgc ggcccgtggg gcaatcaacg cccccatgac
     7021 aaaggctctg gactggagcg gaacaaggta ctgggccccc gatgccaggg tcacaacata
     7081 caatgcaggc cgcttctcca cccctcagcc tttgggggca ttacctggaa ggaccaatcc
     7141 tagggttcct gctcctgctc ggagctcccc cagttcactt tccaatgctc ctactgccac
     7201 ttctgtgtat tcaaatcaaa ctgtttcaac gagactaggt tcttcagctg gttctggtgc
     7261 cggtgtctcg agtctcccgt caactgcaag gactaggagc tgggttgagg accaaaacag
     7321 gaatttgtca cctttcatga ggggggctct caacacatca tttgtcaccc ctccatctag
     7381 tagatcctcc aaccaaggca cagtctcaac cgtgcctaaa gagattttgg actcctggac
     7441 tggcgctttt aacacgcgca ggcagcctct cttcgcacac attcgtaagc gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaaattgat tatctttctt ttctttaatg tcttttaaaa
     7561 aaaaaaaaaa aaaaaaaaaa
//