Typing tool

Complete norovirus genomes

FJ537137  GII.4 Den Haag
 GII.P12

Length: 7,580 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       FJ537137                7580 bp    RNA     linear   VRL 02-NOV-2009
DEFINITION  Norovirus Hu/GII.4/CHDC4108/1987/US, complete genome.
ACCESSION   FJ537137
VERSION     FJ537137.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/CHDC4108/1987/US
  ORGANISM  Norovirus Hu/GII.4/CHDC4108/1987/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7580)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Evolutionary dynamics of GII.4 noroviruses over a 34-year period
  JOURNAL   J. Virol. 83 (22), 11890-11901 (2009)
   PUBMED   19759138
REFERENCE   2  (bases 1 to 7580)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2008) Laboratory of Infectious Diseases,
            Epidemiology Section, Norovirus Gastroenteritis Unit, National
            Institute of Allergy and Infectious Diseases, National Institutes
            of Health, 50 South Drive, BLD 50, Room 6316, Bethesda, MD 20892,
            USA
FEATURES             Location/Qualifiers
     source          1..7580
                     /organism="Norovirus Hu/GII.4/CHDC4108/1987/US"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/CHDC4108/1987/US"
                     /host="Homo sapiens"
                     /db_xref="taxon:660658"
                     /country="USA"
                     /collection_date="1987"
                     /note="genotype: GII.4"
     CDS             5..5104
                     /note="ORF-1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ACT76147.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPRETPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSVKDGVSGLPELSTVRQPD
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTLTTFNFDRNKVLAFRQLAAENKYGLVDTMKVGRQLKDVRTM
                     PELKQALKNISIKRCQIVYSGCTYTLESDGKGNVKVDRVQSATVQTNNELAGVLHHLR
                     CARIRYYVKCAQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETTNKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRENDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQIMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQRWSFTQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6704
                     /note="structural protein; ORF-2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ACT76148.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQAHDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTHIVGSHDYTMNLVSQNWSNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFIPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDG
                     DHHQNEPQQWVLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTVPGCSGYPNMNLDC
                     LLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVL
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6704..7510
                     /note="structural protein; ORF-3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ACT76149.1"
                     /translation="MAGSFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATQKLQQELMKVKQAVLLEGGFSTADAARGAIN
                     APMTKALDWSGTRYWAPDARVTTYNAGRFSTPQPSGALPGRMNPRVPAPARSPPSVLS
                     NAPTATSVYSNQTVSTRLGSSAGSGTGVSSLPSTARTRNWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRIRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaaca ccacaaagac ccccacgacc
      181 acccacccca gaactggtca aaaagatccc ccctcccccg cccaacgggg aggatgaact
      241 agtggtttct tatagtgtca aagatggcgt ttccggcctg cctgagcttt ccactgtcag
      301 gcaaccggat gaagccaaca cggccttcag tgtcccccca ctcaatcaga gggagaatag
      361 ggatgccaag gagccactaa ctggaacaat tctggaaatg tgggacggag agatctacca
      421 ttacggccta tatgtggaac gaggtcttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tatacactcc
      541 ccagtatctc atctccccag acactctcaa gagactgcac ggagaatcgt tcccctatac
      601 agcctttgac aacaattgct atgccttctg ttgttgggtc ttagacctaa acgactcgtg
      661 gctgagtagg cgaatgatcc agagaacaac tggtttcttc aggccctacc aagattggaa
      721 caggaaaccc ctccctacta tggatgactc caaattaaag aaggtagcta acatattcct
      781 gtgtgctcta tcttcactat tcaccaggcc catcaaagac ataataggga agctgagacc
      841 tcttaacatt ctcaacatcc tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 cttgatactc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactaggtg attacgagct acaggggcct gaggaccttg cagtggaact
     1021 cgttccaata gtgatggggg gaattggttt ggtgctggga tttaccaaag agaagattgg
     1081 gaagatgctg tcatctgctg catccacctt aagagcttgt aaagatcttg gtgcatacgg
     1141 gctggaaatc ctaaaattag tcatgaagtg gttcttccca aagaaagagg aggcaaatga
     1201 gctggctatg gtaagatcca tcgaggatgc ggtgttggac ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accctgctca aagacaaaga cagtctggca acctatatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaagctctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gctctcctgg cgagaattgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt tgttgtgatg atatcaggca aaccagggat
     1501 agggaagacc caccttgcca gggaactggc caagagaatc gcagcttccc tcacagggga
     1561 ccagcgtgta ggtctcatcc cacgcaatgg cgtcgaccac tgggacgcgt acaaggggga
     1621 gagggtcgtt ctatgggacg actatggaat gagcaatccc atccatgatg ccctcaggtt
     1681 acaagagctc gctgatactt gccccctcac gctaaactgt gacaggatcg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataattat cactaccaat ctggccaacc cagcgccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgat ttcctcgtgt atgcagatgc
     1861 ccctgaagtc gaaaaggcga aacgtgattt tccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gatttctcgc acataaaact ggcgctggct ccacagggtg gctttgacaa
     1981 gaatggaaat accccacatg ggaagggcgt catgaagact ctcaccactg gctctctcat
     2041 tgcccgagca tcagggctac tccatgagag gttggatgag tacgagctgc agggcccaac
     2101 tctcaccact ttcaactttg atcgcaacaa ggtgcttgcc tttaggcagc ttgctgctga
     2161 gaacaaatac gggctggtgg acacaatgaa agttggaaga cagctcaagg atgtcagaac
     2221 catgccagag cttaaacaag cactcaagaa tatctcaatc aagagatgcc agatagtgta
     2281 cagtggttgc acctacacac ttgagtctga tggcaagggc aatgtaaaag ttgacagagt
     2341 tcagagtgcc accgtgcaga ccaacaacga gctggccggt gtcctacacc acctgaggtg
     2401 tgccagaatt agatattatg tcaagtgtgc ccaggaggcc ctgtattcca tcattcaaat
     2461 tgccggagct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctctg
     2521 gtccaagcca caggtggaag acacagagga gactaccaac aaggatgggt gccccaaacc
     2581 caaagatgat gaggagttcg tcgtctcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttt tcaagtaaag gtctcagtga
     2701 tgaagaatac gatgagtaca aaaggatcag ggaagaaagg aacggcaagt actccataga
     2761 agagtacctt caggacaggg acaagtacta tgaggaggta gccattgcca gggcgaccga
     2821 ggaggacttc tgtgaagagg aagaggccaa gattcggcaa aggattttta ggccaacaag
     2881 gaaacaacgc aaggaggaga gggcctctct cggtttagtc acaggctctg aaatcaggaa
     2941 gaggaaccca gatgatttca agcctaaagg aaagctgtgg gctgatgacg acaggagtgt
     3001 tgactacaat gagagactca attttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tttgggtttc tcccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agtttttcgg agtccccatc aaacaaattc agatacacaa
     3181 atcgggcgaa ttctgtcgct tgaggttccc aaaaccgatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggcac cgtggccaca ctactcatca agaggccaac
     3301 tggagaactt atgcccttag cagccagaat gggaacccat gcaaccatga aaattcaagg
     3361 gcgcactgtt ggaggccaaa tgggcatgct tctgacagga tccaacgcca aaagtatgga
     3421 tctaggcacc acaccaggtg actgtggctg tccctacatc tacaagaggg aaaatgacta
     3481 tgtggttatt ggagtccaca cggctgccgc tcgtggagga aacactgtca tatgtgccac
     3541 ccaagggagt gagggagaag ccacacttga aggcggtgac aataagggaa cctactgtgg
     3601 tgcaccaatc ctaggtccag gaagtgcccc aaaactcagc accaagacta aattctggag
     3661 atcatccaca acaccactcc cacctggcac ctatgaacca gcctaccttg gtggtaagga
     3721 ccccagagtc aagggcggcc cttcattgca acaaattatg agggaccagc tgaaaccatt
     3781 cacagagccc aggggcaaac caccaaagcc aagtgtgtta gaggctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgatcc acctcagagg tggtcattca cgcaagcctg
     3901 cgcgtccctc gacaagacta cttccagtgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagct ggcagatcag gcttccaagg ccaacttgat
     4021 gttcgaagag gggaagaaca tgaccccagt ttacacaggt gcgcttaagg atgagctggt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctc ctctggggct cagacttagc
     4141 gaccatgatc cggtgcgcta gagcattcgg gggcctgatg gatgaactca aggctcactg
     4201 tgttacactt cctgtcagag ttggtatgaa tatgaatgaa gatggcccca tcatcttcga
     4261 gagacactcc agatatacat atcactatga tgccgattac tctcggtggg attcaacaca
     4321 acaaagggcc gtgctagcag cagccctaga aatcatggtt aaattctccc cagaaccgca
     4381 tctggcccag atagttgcag aagaccttct ctcccctagt gtgatggatg tgggtgactt
     4441 caaaatatca atcaatgagg gcctcccctc tggagtaccc tgcacttctc aatggaattc
     4501 catcgcccac tggctcctca ccctctgtgc actctctgaa gttacaaatc tgtcccctga
     4561 cattattcag gctaattccc tcttctcctt ttacggtgat gatgaaattg tcagtacaga
     4621 tataaagttg gacccagaga aactgacagc aaagctcaag gaatacggat tgaaaccaac
     4681 ccgccctgat aaaactgagg ggccccttgt tatctctgaa gacttgaatg gtctaacctt
     4741 cctgcggaga actgtgaccc gcgatccagc tggctggttt ggaaaattgg atcagagctc
     4801 aatacttagg caaatgtact ggactagagg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt aatgtcttta ctgggcgagg ccgcactcca
     4921 cggcccagca ttctatagca aaattagcaa gctagtcatt gcagagctga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga tccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tgtcccctag aaacgctcca ggtgagatac tatggagcgc gcccttgggc cccgatttga
     5341 atccctatct ttcccatttg tccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aagtaatcct cgcggggaac gcgttcaccg ccgggaaagt catatttgca gcagttccac
     5461 caaactttcc aactgaaggc ctaagcccca gccaggttac tatgttcccc catataattg
     5521 tagatgttag gcaattggaa cctgtgttaa tccccctacc tgatgttagg aataatttct
     5581 accactacaa tcaagcacat gattctacac ttaagttgat agcaatgttg tacacaccac
     5641 tcagagctaa taatgccggg gatgacgtct tcacagtctc ttgtcgagtt cttacgaggc
     5701 catcccccga ttttgatttt atattcctgg tgccacccac agttgaatca agaactaaac
     5761 cattcactgt cccaatttta actgttgagg aaatgtctaa ttcaagattt cccattcctt
     5821 tagaaaagct atacacgggt cctagcagtg cttttgttgt ccaaccacaa aatggcagat
     5881 gtacgactga tggcgtactc ttaggcacta cccagctgtc agctgtcaat atctgtaact
     5941 tcagggggga tgtcacccat attgtgggta gccatgacta tacaatgaat ttggtatccc
     6001 aaaattggag caattatgac ccaacagaag aaatcccagc ccccctggga acgccagatt
     6061 ttgtgggaaa gatccaaggc ttactcaccc agaccacaag agcggacggc tcgacccgtg
     6121 cccacaaagc tacagtgagc actgggagtg tccacttcat tccaaagctg ggtagtgtcc
     6181 aattcaccac ggacacgaat aatgacttcc aaactggcca aaacacaaaa ttcaccccag
     6241 ttggtgtcat ccaagacggt gatcaccatc agaatgaacc ccaacaatgg gtactcccaa
     6301 attactcagg tagaactggt cataatgtgc atctggcccc tgccgtcgcc cccacttttc
     6361 cgggcgagca gcttcttttc tttagatcca ctgtgcccgg ttgtagcggg taccccaaca
     6421 tgaatctgga ttgcctactc cctcaggaat gggtgtcgca cttttaccag gaagcagctc
     6481 cagcacaatc cgatgtggct ctgctgagat ttgtgaatcc agatacaggt agggttctgt
     6541 ttgagtgcaa gctccataaa tcaggctata tcacagtggc tcacaccggc ccgtatgatt
     6601 tggttctccc ccccaatggt tatttcagat ttgattcttg ggtcaaccag ttctacacac
     6661 tcgcccccat gggaaatgga acggggcgta ggcgtgcatt ataatggctg gatctttctt
     6721 tgctggattg gcatctgatg tcctcggctc tggacttggt tctctaatca atgctggagc
     6781 tggagccatc aatcaaaaag ttgaatttga aaacaataga aaattacaac aagcttcctt
     6841 ccaatttagt agtaatctac aacaggcttc cttccaacat gataaggaga tgctccaagc
     6901 acaaattgag gctactcaga aattgcaaca agaactgatg aaggttaaac aggcagtgct
     6961 tctagagggt ggattttcca cagcagacgc ggcccgcggg gcaatcaacg cccccatgac
     7021 aaaggctctg gactggagcg ggacaaggta ctgggccccc gatgccaggg tcacaacata
     7081 caatgcaggc cgcttttcca cccctcagcc ttcgggggca ttgccaggaa ggatgaatcc
     7141 tagggtcccc gctcctgctc ggagtccccc cagtgtgctt tctaatgctc ctactgctac
     7201 ttctgtgtat tcaaatcaaa ctgtctcaac gagactaggt tcttcagctg gttctggtac
     7261 tggtgtctcg agtctcccgt caactgcaag gactaggaat tgggttgagg accaaaacag
     7321 gaatttgtca cctttcatga ggggggctct caacacatca ttcgtcaccc ctccatctag
     7381 tagatcctcc agccaaggca cagtctcaac cgtgcctaaa gaaattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagcctct cttcgctcac attcgtatac gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaaattgat tatctttcct ttctttagtg tcttttaaaa
     7561 aaaaaaaaaa aaaaaaaaaa
//