Typing tool

Complete norovirus genomes

FJ537136  GII.4
 GII.P12

Length: 7,580 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       FJ537136                7580 bp    RNA     linear   VRL 02-NOV-2009
DEFINITION  Norovirus Hu/GII.4/CHDC3967/1988/US, complete genome.
ACCESSION   FJ537136
VERSION     FJ537136.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/CHDC3967/1988/US
  ORGANISM  Norovirus Hu/GII.4/CHDC3967/1988/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7580)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Evolutionary dynamics of GII.4 noroviruses over a 34-year period
  JOURNAL   J. Virol. 83 (22), 11890-11901 (2009)
   PUBMED   19759138
REFERENCE   2  (bases 1 to 7580)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2008) Laboratory of Infectious Diseases,
            Epidemiology Section, Norovirus Gastroenteritis Unit, National
            Institute of Allergy and Infectious Diseases, National Institutes
            of Health, 50 South Drive, BLD 50, Room 6316, Bethesda, MD 20892,
            USA
FEATURES             Location/Qualifiers
     source          1..7580
                     /organism="Norovirus Hu/GII.4/CHDC3967/1988/US"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/CHDC3967/1988/US"
                     /host="Homo sapiens"
                     /db_xref="taxon:660657"
                     /country="USA"
                     /collection_date="1988"
                     /note="genotype: GII.4"
     CDS             5..5104
                     /note="ORF-1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ACT76144.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSVKDGVSGLPELSTVRQPD
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTLTIFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKRCQIVYSGCTYTLESDGKGSVKVDRVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETTSKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRENDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLRPFTEP
                     RGKPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFTQACASLDKTTSSGHPHHIRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEITNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6704
                     /note="structural protein; ORF-2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ACT76145.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNIIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSHDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTHIVGSHDYTMNLVSQNWSNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDG
                     DHHQNEPQQWVLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVLHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6704..7510
                     /note="structural protein; ORF-3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ACT76146.1"
                     /translation="MAGSFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATQKLQQDLMKVKQAVLLEGGFSTTDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRTNPRVPVLSRGPPSTLS
                     NASTATSVYSNQTVSTRLGSSAGSGTSVSSLPSTARTRNWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSNQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acccacccca gaattggtca aaaagatccc ccctcccccg cccaacgggg aggatgaact
      241 agtggtttct tatagtgtca aagatggcgt ttccggtctg cctgagcttt ccactgtcag
      301 gcaaccggat gaagccaata cggccttcag tgttccccca ctcaaccaga gggagaatag
      361 ggatgccaag gagccactaa ctggaacaat tctggaaatg tgggatggag agatctacca
      421 ttatggccta tatgtggagc gaggtcttgt acttggcgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggtcgaac taacaccact ctccttgttt tggagacctg tatacacccc
      541 ccagtacctc atctccccag acactctcaa gagattgcac ggagaatcgt tcccctatac
      601 agcctttgac aacaattgct atgccttctg ttgctgggtc ttagacttaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggtttcttt agaccctacc aagattggaa
      721 taggaaaccc ctccctacta tggatgactc caaattaaag aaggtagcta acatattcct
      781 gtgtgctcta tcttcactgt tcaccaggcc catcaaagac ataataggga aactaagacc
      841 tcttaacatc ctcaacatct tagcctcatg tgattggact tttgcaggta tagtggaatc
      901 cttgatactc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttgctgggtg attacgagtt acagggccct gaggaccttg cagtggaact
     1021 cgttccaata gtgatggggg gaattggttt ggtactagga ttcaccaaag agaagattgg
     1081 gaagatgttg tcatctgctg catccacctt aagagcctgt aaagatcttg gtgcatacgg
     1141 gctggaaatc ctaaaattag tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgagatcca tcgaggatgc ggtgctggac ctcgaggcaa ttgaaaacaa
     1261 ccacatgacc accctgctca aagataaaga cagcctggca acctatatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaagctctc aaccaagtct gcttcacctg atatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt tgttgtgatg atatcaggca gaccagggat
     1501 agggaagacc caccttgcca gggagctggc caagagaatc gcagcttccc tcacaggaga
     1561 ccagcgtgtg ggtctcatcc cacgcaatgg cgtcgaccac tgggacgcat acaaggggga
     1621 aagggtcgtc ctatgggacg actatggaat gagtaatccc atccatgacg cccttaggtt
     1681 acaagaactc gctgacactt gccccctcac tctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgacg ctataattat caccactaat ctggccaacc cagcaccatt
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgat ttcctcgtgt atgcagatgc
     1861 ccctgaagtc gagaaggcga aacgtgattt tccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gatttctcgc acataaaact aactctggct ccacagggtg gcttcgacaa
     1981 gaatggaaac accccacatg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgagca tcagggctac tccatgagag attagatgag tatgagctgc agggcccaac
     2101 tctcaccatt ttcaactttg atcgcaacaa ggtgcttgct tttaggcagc ttgctgctga
     2161 aaataaatac gggctgatgg acacaatgaa agttggaaga cagctcaagg atgtcagaac
     2221 catgccagag ctcaaacaag cactcaagaa tatttcaatc aagaggtgcc agatagtgta
     2281 cagtggatgc acctatacac ttgagtctga tggcaagggc agtgtgaaag ttgacagagt
     2341 tcagagcgct accgtgcaga ccaacaacga gctggccggt gccctacacc atctaaggtg
     2401 tgccagaatt agatactatg tcaagtgtgt ccaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtca ccacgcgcat cgtcaagcgc atgaatatac aagacctctg
     2521 gtccaagcca caagtagaag acacagagga gactaccagc aaggacgggt gcccaaaacc
     2581 caaagacgat gaggagttcg tcgtctcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagcaaag gtctaagtga
     2701 tgaagagtac gatgagtaca agaggatcag agaagaaaga aacggtaagt actccataga
     2761 agagtacctt caggaccggg acaagtacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaggacttc tgtgaagagg aggaggccaa gattcggcag aggattttca ggccaacaag
     2881 gaaacaacgc aaggaggaga gggcctctct cggtttagtc acaggctctg aaatcaggaa
     2941 gaggaaccca gatgatttca agcccaaggg aaaactgtgg gctgatgacg acaggagcgt
     3001 agactacaat gagagactca gttttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tttgggtttc tcccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agttcttcgg agtccccatc aaacaaattc agatacacaa
     3181 atcgggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggcac cgtggccaca ctactcatca agaggccaac
     3301 tggagaactt atgcccttag cagccagaat ggggacccat gcaaccatga agattcaagg
     3361 acgcactgtt gggggccaaa tgggcatgct cctgacagga tccaacgcca aaagtatgga
     3421 cctaggcact acaccaggtg actgtggctg tccctacatc tacaagaggg aaaatgacta
     3481 cgtggttatt ggagtccaca cggctgccgc tcgtgggggt aacactgtta tatgtgccac
     3541 ccaggggagt gaaggagagg ctacacttga aggcggtgac agtaagggaa cctactgtgg
     3601 tgcaccaatc ctaggcccag gaagtgcccc aaaactcagc accaagacta aattctggag
     3661 atcatctaca acaccactcc cacctggcac ctatgaacca gcctaccttg gtggtaagga
     3721 ccccagggtc aagggtggcc cttcattgca acaagttatg agggaccagc tgagaccatt
     3781 tacagaaccc aggggcaaac caccaaagcc aagtgtgttg gaggctgcca agaaaaccat
     3841 cgtcaatgtc cttgaacaaa caattgatcc acctcagaaa tggtcattca cgcaagcttg
     3901 cgcgtccctc gacaagacta cttccagtgg ccacccgcac cacatacgga aaaatgactg
     3961 ctggaacggg gaatccttca caggtaagtt ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaagag gggaagaaca tgaccccagt ttacacaggt gcgctcaagg atgagctggt
     4081 caaaactgac aaaatttatg gcaagatcaa gaagaggctt ctctggggct cggacttagc
     4141 gaccatgatc cggtgcgctc gagcattcgg aggcctaatg gatgaactca aggcacactg
     4201 tgttacacta cctgtcagag ttggcatgaa catgaatgag gatggcccca tcatctttga
     4261 gaggcattcc agatacaaat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagggcc gtattagcag cagccctaga aatcatggtt aaattctccc cagaaccaca
     4381 tctggcccag atagttgcag aagaccttct ctctcctagt gtgatggatg tgggtgactt
     4441 caaaatatca atcaatgagg gcctcccctc tggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctctgtgc actctccgaa atcacaaact tgtcccctga
     4561 cattatacag gctaattccc tcttctcctt ttatggtgat gatgaaattg tcagtacaga
     4621 tataaagttg gacccagaga aattgacagc aaaactcaag gaatacgggt tgaaaccaac
     4681 ccgccctgac aagactgagg gaccccttgt tatctctgaa gacttgaatg gtctgacctt
     4741 cctgcggagg actgtgaccc gcgacccagc tggctggttt ggaaaattgg aacagagctc
     4801 aatacttagg caaatgtact ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaact aatgtcttta ctgggcgagg ccgcactcca
     4921 cggcccggca ttctacagca aaattagcaa gctagtcatt gcagagctga aggaaggtgg
     4981 catggatttt tacgtgccca ggcaagaacc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gttggtgctg ctattgcagc acctgtagcg ggccaacaaa
     5221 atataattga cccctggatt agaaacaatt ttgtacaagc ccctggtggt gagtttacag
     5281 tgtcccctag aaacgctcca ggtgagatac tatggagcgc gcccttgggc cctgatttga
     5341 acccctatct ttctcatctg tccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aagtaattct cgcggggaac gcgttcaccg ccgggaaagt tatatttgcg gcagttccac
     5461 caaactttcc aactgaaggc ttaagcccca gccaggtcac tatgttcccc catataattg
     5521 tagatgttag gcaattggaa cctgtgttga tccccctacc tgatgttagg aataatttct
     5581 atcattataa tcaatcacat gattctaccc ttaagctgat agcaatgttg tatacaccac
     5641 tcagagctaa taatgccggg gatgatgtct tcacagtctc ttgtcgagtt ctcacgaggc
     5701 catcccccga ttttgatttt atattccttg tgccacccac agttgaatca agaaccaaac
     5761 cattcactgt cccaatctta actgttgagg aaatgtctaa ttcaagattc cccattcctt
     5821 tggaaaagtt atatacgggt cctagcagtg cttttgttgt ccaaccacaa aatggcagat
     5881 gtacgactga tggcgtgctc ttaggcacta cccagctgtc agctgtcaat atctgtaact
     5941 tcagggggga tgtcacccac attgtgggca gccatgatta tacaatgaat ctggtatccc
     6001 aaaattggag caattatgac ccaacagaag aaatcccagc ccccctggga acaccagatt
     6061 tcgtgggaaa gatccaaggc ctgctcaccc agaccacaag agcggatggc tcgacccgtg
     6121 cccacaaggc tacagtgagc actgggagcg tccacttcac tccaaagctg ggtagtgttc
     6181 aattcaccac tgacacaaac aatgatttcc aaactggcca aaacacgaaa ttcacaccag
     6241 ttggcgtcat ccaagacggt gatcaccacc agaatgaacc ccaacaatgg gtgctcccaa
     6301 attactcagg tagaactggt cataatgtgc acctggcccc tgccgttgcc cccacttttc
     6361 cgggtgagca actccttttc ttcaggtcca ctatgcccgg atgtagcggg taccccaaca
     6421 tgaacttgga ttgtctactc ccccaggaat gggtgctgca cttctaccag gaagcagctc
     6481 cagcacaatc cgatgtggct ctgctgagat ttgtgaatcc agacacaggt agggtcctgt
     6541 ttgagtgcaa gctccataag tcaggctata tcacagtggc tcacaccggc ccgtatgatt
     6601 tggttatccc ccccaatggt tattttagat ttgattcctg ggtcaaccag ttctacacac
     6661 ttgcccccat gggaaatgga acggggcgca ggcgtgcatt ataatggctg gatctttctt
     6721 tgctggattg gcatctgacg tcctcggctc tggactcggt tctctaatca atgctggagc
     6781 tggagccatc aatcaaaaag ttgaatttga aaacaacaga aaattacagc aagcttcctt
     6841 ccaattcagt agtaacctac aacaggcttc cttccaacat gataaagaga tgctccaagc
     6901 acagattgag gctactcaaa aattgcaaca agatctgatg aaggttaaac aggcagtgct
     6961 cctagagggt ggattttcca caacagatgc agcccgtggg gcaatcaacg cccccatgac
     7021 aaaggctctg gactggagcg gaacaaggta ctgggcccct gatgccagga ccacaacata
     7081 caatgcaggc cgcttttcca cccctcagcc ttcgggagca ttgccaggaa gaactaatcc
     7141 cagggttccc gttctctctc ggggcccccc cagtacactt tctaatgctt ctactgccac
     7201 ttctgtgtat tcaaatcaaa ctgtttccac gagactaggt tcttcagctg gttctggtac
     7261 tagtgtctcg agtctcccgt caactgcaag aactaggaac tgggttgagg accaaaacag
     7321 gaatttgtca cctttcatga gaggggctct caacacgtca ttcgtcaccc ctccatctag
     7381 tagatcctct aaccaaggca cagtctcaac cgtgcctaaa gaaattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagcctct cttcgctcac attcgcaagc gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaaattgat tatctttctt ttctttagtg tcttttaaaa
     7561 aaaaaaaaaa aaaaaaaaaa
//