Typing tool

Complete norovirus genomes

FJ537135  GII.4
 GII.PNA3

Length: 7,576 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       FJ537135                7576 bp    RNA     linear   VRL 02-NOV-2009
DEFINITION  Norovirus Hu/GII.4/CHDC2094/1974/US, complete genome.
ACCESSION   FJ537135
VERSION     FJ537135.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/CHDC2094/1974/US
  ORGANISM  Norovirus Hu/GII.4/CHDC2094/1974/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7576)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Evolutionary dynamics of GII.4 noroviruses over a 34-year period
  JOURNAL   J. Virol. 83 (22), 11890-11901 (2009)
   PUBMED   19759138
REFERENCE   2  (bases 1 to 7576)
  AUTHORS   Bok,K., Abente,E.J., Realpe-Quintero,M., Mitra,T., Sosnovtsev,S.V.,
            Kapikian,A.Z. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-DEC-2008) Laboratory of Infectious Diseases,
            Epidemiology Section, Norovirus Gastroenteritis Unit, National
            Institute of Allergy and Infectious Diseases, National Institutes
            of Health, 50 South Drive, BLD 50, Room 6316, Bethesda, MD 20892,
            USA
FEATURES             Location/Qualifiers
     source          1..7576
                     /organism="Norovirus Hu/GII.4/CHDC2094/1974/US"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/CHDC2094/1974/US"
                     /host="Homo sapiens"
                     /db_xref="taxon:660656"
                     /country="USA"
                     /collection_date="1974"
                     /note="genotype: GII.4"
     CDS             5..5104
                     /note="ORF-1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ACT76141.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEGEPVVSYSVKDGVSGLPELSTVRQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYAPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEASELAMVRSIEDAVLDLEAIENNHLTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKKIATTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTIGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGGQLKGVRTM
                     PELKQALKNISIKRCQIVYGGSTYTLESDGKGGVKVDRVQSTTVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQLENTEEAASKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGTQEFFGVSIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVGIGVHTAAAHGENTVICATQGSEGEATLEGGDNKGAYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPPYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKQPKPSVLEAAKRTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHIRKNECW
                     NGDSFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRPILAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPFGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIQLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6704
                     /note="structural protein; ORF-2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ACT76142.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNIIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLSPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAIPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQAHDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDG
                     DHHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVSHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGSGRKRVL"
     CDS             6704..7510
                     /note="structural protein; ORF-3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ACT76143.1"
                     /translation="MAGSFFAGLASDVLGSGLGSLINAGAGAINQRVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIDATQKLQQGLMQIKQAVLLEGGFSAADAARGAIN
                     APMTKTLDWSGTRYWAPEARVTTYNAGHFSPSQPSRTPSGRISSVTSASVRNSPSLSS
                     KSSTATTVYSNQTVSTRLGSSAGSGTSVSSLPSASRTRSWVEDQNRSVSPFMRGALNT
                     SFVTPPSSRSSNQSTVSTVPKEILDSWTGAFNTRRQPLFAYIHKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtact ttctagtatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaagc agccgccccc gagggagata ccacaaagac ccccacgacc
      181 gcccactccg gagttggtca agaaaatccc tccccccccg cccaacgggg agggtgagcc
      241 agtggtctct tacagtgtca aagatggcgt ttccgggttg cctgagctct ccactgtcag
      301 gcaaccagat gagaccaaca cggcatttag tgttccccca ctcaaccaga gagagaacag
      361 ggatgccaag gagccactga ctggaacaat cctggagatg tgggacgggg aaatctacca
      421 ttatggcttg tacgttgaac gaggcctggt gcttggcgtg cacaaaccac cagcagccat
      481 tagccttgcc aaggttgaat tggcaccact ttctttgttc tggagacctg tgtacgcccc
      541 ccagtatctc atctccccag acactctcag gagactgcat ggggaatcat tcccctacac
      601 agcctttgac aacaactgct atgccttctg ttgctgggtt ttagacctga acgattcgtg
      661 gctgagtagg aggatgatac agaggacaac tggcttcttc aggccttacc aagactggaa
      721 taggaaaccc cttcccacca tggatgactc caaactgaag aaggtggcca acatattcct
      781 gtgtgctttg tcttcactat tcaccaggcc catcaaggac ataataggga agctaaggcc
      841 tcttaacatc ctcaacattt tggcttcatg tgattggacc tttgcaggca tagtggaatc
      901 cctaattctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactgggtg actatgagct acaggggcct gaggacctcg cggtagagct
     1021 agtgccagta gtgatggggg ggataggttt ggtgttggga ttcaccaaag aaaagattgg
     1081 gaagatgttg tcatctgctg catccacatt gagggcttgt aaagaccttg gtgcatatgg
     1141 actggagatc ctaaaactag tcatgaaatg gttcttccca aagaaagagg aagcaagcga
     1201 gttagccatg gtgagatcta tcgaggacgc ggtgttggac ctcgaagcaa ttgagaacaa
     1261 tcacttgacc accctgctta aggacaagga cagcctggcg acttacatga gaactcttga
     1321 ccttgaggaa gagaaagcca ggaagctctc aaccaagtcc gcctcacctg atatcgtggg
     1381 tacaatcaac gctctcctgg caaggattgc ggctgcccgc tccctagtac atcgggcaaa
     1441 ggaagaactt tccagcagac cgagacccgt tgttgtgatg atatcaggaa agccagggat
     1501 aggaaagact cacctagcca gagagctggc caagaagatc gcaaccaccc tcacagggga
     1561 ccagagggtg ggcctcatcc cacgcaatgg cgttgaccac tgggatgcat acaagggaga
     1621 gagggtcgtc ctttgggacg actacgggat gagcaacccc atccatgacg ctctcagatt
     1681 gcaggagctt gctgacactt gccccctgac actaaattgt gataggattg aaaacaaagg
     1741 taaagttttt gacagtgatg ccataattat caccaccaac ttggccaacc cagcaccact
     1801 ggactatgtc aattttgagg cctgctcgag gcgcattgat ttcctcgtgt acgccgacgc
     1861 ccctgatgtc gaaaaggcga agcgcgactt cccaggccaa cctgacatgt ggaaaaatgc
     1921 tttcagccct gatttctctc acataaagct gatgctggcc ccacagggtg gttttgacaa
     1981 gaacggcaac accccacatg ggaagggcgt catgaagacc ctcaccattg gttccctcat
     2041 cgcccgtgct tcagggctcc tccacgagag gctggatgag tacgagctgc aaggcccagc
     2101 cctcacaacc ttcaactttg accgaaacaa agtgctcgct ttcagacagc ttgctgctga
     2161 aaataagtac ggactgatgg acacaatgag ggttggaggg caactcaagg gcgttagaac
     2221 catgccagag ctcaagcaag cactcaagaa catttcaatt aagaggtgcc agatagtgta
     2281 tggtggcagc acttatacac ttgaatctga tggcaagggt ggtgtgaagg tcgacagagt
     2341 tcagagtacc accgtacaga ccaataatga gttagccggc gccctgcacc acctcaggtg
     2401 cgccaggatc aggtactatg tcaagtgtgt ccaggaggcc ctgtactcca tcatccaaat
     2461 tgcaggggcc gcatttgtca ccacgcgcat tgtcaagcgc atgaacatac aggacctttg
     2521 gtccaagcca caactggaga acacagaaga agctgctagc aaagatgggt gcccaaaacc
     2581 caaagatgat gaggagtttg ttgtttcatc tgatgacatc aagaccgagg gtaagaaagg
     2641 aaagaacaag actggtcgcg gcaagaagca cacagccttc tcgagtaagg gtctcagtga
     2701 cgaggagtac gatgagtaca aaagaatcag ggaggaaaga aacggcaagt actctataga
     2761 ggagtatctc caagacagag acaagtatta tgaggaggtt gccattgcca gggcgactga
     2821 ggaggacttc tgcgaagaag aagaggccaa gatccgtcaa agaatcttta gaccaacaag
     2881 gaagcaacgc aaggaggaga gggcttctct cggtttagtc acaggctctg agatcagaaa
     2941 aagaaaccca gatgacttca aacccaaggg aaaactgtgg gccgatgacg acagaagtgt
     3001 cgattacaat gagaaactca gttttgaagc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggttcg ggttggggtt tctgggtttc tcctagtctg ttcataacat caactcatgt
     3121 tataccccag ggcacacagg agttctttgg ggtgtccatc aaacaaatcc aggtacacaa
     3181 atcaggcgaa ttttgccgct tgaggttccc aaagccaata aggactgatg tgacgggcat
     3241 gatcttagag gaaggtgccc ccgaagggac cgtggccaca ctactcatca agaggccaac
     3301 tggtgagctc atgcccttag cggccaggat gggcactcac gcaaccatga agatccaagg
     3361 tcgcactgtt gggggccaaa tgggtatgct cctgacaggg tccaatgcca aaagtatgga
     3421 cttgggcacc acacccggcg actgtggttg tccctacatc tacaagagag ggaacgacta
     3481 cgtgggcatc ggagttcaca cagccgctgc ccatggagaa aacactgtca tatgtgccac
     3541 ccagggaagt gaaggtgagg ccacacttga aggcggggat aataaaggtg cttactgtgg
     3601 tgccccgatc ttaggtccag gaagtgcccc aaaactcagc accaaaacca agttctggag
     3661 gtcatccaca gcaccactcc ctcctggtac ctatgagcca ccctacctcg gtggtaagga
     3721 tcccagggtt aagggtggtc catcactaca acaagtcatg agggaccagt tgaaaccatt
     3781 cactgaacca agaggtaaac aaccaaaacc aagtgtgttg gaagctgcca agagaaccat
     3841 cattaatgtt cttgaacaaa caatagaccc acctcagaaa tggtcatttg cgcaagcttg
     3901 cgcttctctt gacaaaacca cctccagtgg ccatccacac catatacgga agaatgaatg
     3961 ctggaatgga gattccttta caggtaaatt ggcagaccag gcctcaaagg ccaacttgat
     4021 gtttgaggag ggaaagaaca tgactccagt ttacacaggt gccctcaagg atgagttagt
     4081 caaaactgac aagatatatg gcaagatcaa gaagaggcta ctttggggat cggacctggc
     4141 aaccatgatc cggtgtgccc gggctttcgg aggcctaatg gatgaactca aggctcactg
     4201 tgtcacactc cctgtcagag ttggtatgaa catgaatgaa gacggcccca tcatctttga
     4261 aaaacattct aggtacaggt accactatga tgcagattac tctcgatggg actcaacaca
     4321 acagagaccc atattggctg cagccctaga gatcatggtc aaattctccc cagagccaca
     4381 cttagctcaa atagttgcag aagaccttct atcccccagt gtgatggatg taggtgattt
     4441 taagatatca atcaacgagg gccttccctt tggggtgcct tgcacctcac aatggaactc
     4501 catcgcccac tggctcctca ccctctgtgc actctctgaa gttacggacc tctcccctga
     4561 catcatccag gctaattctc tcttctcttt ctatggtgat gatgaaattg tgagtacaga
     4621 catacaattg gacccagaaa aactgacagc aaagctaaag gaatacgggc tgaagccaac
     4681 tcgccctgat aagactgagg gacctctgat tatttctgag gacctaaatg gtttaacctt
     4741 ccttcggagg accgtgaccc gcgacccagc tggttggttt ggtaaattgg aacagagttc
     4801 gatactcagg cagatgtact ggaccagggg ccccaaccat gaggaccctt ctgaaacaat
     4861 gataccacat tcccaaaggc ccatacaact gatgtccctg ctgggtgagg ctgcactgca
     4921 tggcccagcg ttctacagca aaatcagcaa gctagtcatc acagagctaa aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc gatgttcagg tggatgaggt tctcagacct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcctgtt gtcggtgctg ccattgcagc acctgtggca ggccaacaaa
     5221 atataattga cccctggatt agaaataatt ttgtgcaagc ccctggtgga gagttcacag
     5281 tgtcccctag aaatgctcca ggtgagatac tatggagcgc gcccttgagc cctgatttga
     5341 acccctatct ttctcacctg tccagaatgt acaatggtta tgcaggtggc tttgaagtgc
     5401 aggtaatcct cgcagggaat gcgttcactg ccgggaaaat catatttgca gcaattccac
     5461 caaattttcc aactgaaggc ttaagcccta gccaggttac aatgttcccc cacataattg
     5521 tagatgtcag gcaattggaa cctgtattaa tccccctacc tgatgttagg aataatttct
     5581 atcattataa tcaagcacat gattctactc tcaaattgat agcaatgttg tatacaccac
     5641 tcagagccaa taatgccggg gatgatgtct tcacagtctc ttgtcgagtc ctcacgagac
     5701 catcccccga ttttgatttc atattcctgg tgccacccac agtcgagtca agaactaagc
     5761 cattcactgt ccctatctta actgttgagg aaatgtccaa ttcaagattc cccattccct
     5821 tagaaaagtt gtatacgggt cctagcagtg cttttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctt ctaggcacta ctcagttgtc agctgtcaat atctgtaatt
     5941 tcagggggga tgtcacccgt gttgggatca gccatgatta cacaatgaat ttggtgtccc
     6001 aaaattggaa taactatgat ccaacagagg aaatccctgc tcccctggga acaccagact
     6061 ttgtgggtaa gatccaaggt ctgctcactc aaaccacaag agcagacggc tcgactcgtg
     6121 cccacaaagc cacagtgagc actgggagcg ttcacttcac cccaaagctg ggtagtgtcc
     6181 aattcaccac cgacacaaac aatgactttc aaactggcca aaatacaaaa ttcaccccag
     6241 ttggtgtcat ccaagatggt gatcaccacc agaatgaacc ccaacaatgg gtgctcccaa
     6301 attactcagg cacctctggt cacaatgtgc atctggcccc tgccgttgct cccactttcc
     6361 ccggtgagca gcttcttttc tttaggtcca ccatgcccgg gtgcagcggg taccctaaca
     6421 tgaatttgga ttgcctgctc ccacaggagt gggtgtcgca cttctatcag gaagcagccc
     6481 cagcacaatc agatgtggcc ctgctgagat ttgtgaatcc agatacaggt agggttttgt
     6541 ttgagtgcaa actccataaa tcaggctaca tcacagtggc tcacactggt ccgtatgatt
     6601 tggttattcc ccccaatggt tatttcagat ttgattcttg ggtcaaccag ttttacacac
     6661 ttgcccccat gggaaatgga tcggggcgca agcgtgtgtt ataatggctg gatctttctt
     6721 tgctggattg gcatctgatg ttcttggttc tggacttggt tctctaatca atgccggagc
     6781 cggagcgatc aatcaaagag tggaatttga aaataatagg aaattacagc aagcttcctt
     6841 ccaatttagc agcaatttac aacaagcttc ctttcaacat gacaaagaaa tgcttcaggc
     6901 tcaaattgat gctactcaaa aattgcagca gggcttaatg cagatcaagc aggcggtgct
     6961 tctggaaggt gggttttctg cggcagacgc cgctcgtggg gcaatcaacg cgcccatgac
     7021 aaaaaccctg gactggagtg gaactaggta ctgggctccc gaggccagag tcacaacata
     7081 caatgcaggc catttctccc cttcccagcc ttctaggacg ccgtctggga ggattagttc
     7141 tgtgacttct gcatctgtgc gaaattcccc cagcttatct tctaaatctt ctactgctac
     7201 aactgtgtat tctaatcaaa ctgtttcaac gagacttggt tcttcagctg gttctggaac
     7261 cagtgtctcg agcctcccgt cggcttccag aaccaggagc tgggttgagg accaaaacag
     7321 gagcgtgtca cccttcatga ggggagcact caacacatca tttgttactc ctccatctag
     7381 cagatcctct aaccagagca cagtctcaac cgtacccaaa gaaattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagccgct cttcgcatac atccataagc gaggggagtc
     7501 acgggtttga agtgaaaaga caatctgatc tttctttatt ttaatgtctt ttaaaaaaaa
     7561 aaaaaaaaaa aaaaaa
//