Typing tool

Complete norovirus genomes

FJ515294  GI.2
 GI.P2

Length: 7,699 | 3 CDS

ORF1: 5..5371
ORF2: 5355..6995
ORF3: 6995..7630
LOCUS       FJ515294                7699 bp    RNA     linear   VRL 01-JAN-2010
DEFINITION  Norovirus Hu/GI.2/Leuven/2003/BEL, complete genome.
ACCESSION   FJ515294
VERSION     FJ515294.1
KEYWORDS    .
SOURCE      Norovirus Hu/GI.2/Leuven/2003/BEL
  ORGANISM  Norovirus Hu/GI.2/Leuven/2003/BEL
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7699)
  AUTHORS   Wollants,E., Verbeeck,J. and Van Ranst,M.
  TITLE     Long-term asymptomatic excretion of a genogroup I norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7699)
  AUTHORS   Wollants,E., Verbeeck,J. and Van Ranst,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-DEC-2008) Laboratory of Clinical Virology, Rega
            Institute for Medical Research, KU Leuven, Minderbroedersstraat 10,
            Leuven 3000, Belgium
FEATURES             Location/Qualifiers
     source          1..7699
                     /organism="Norovirus Hu/GI.2/Leuven/2003/BEL"
                     /mol_type="genomic RNA"
                     /strain="Hu/GI.2/Leuven/2003/BEL"
                     /isolation_source="patient"
                     /host="Homo sapiens"
                     /db_xref="taxon:658397"
                     /country="Belgium"
                     /collection_date="2003"
                     /note="subtype: 2; genotype: genogroup I"
     CDS             5..5371
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ACU56257.1"
                     /translation="MMMASKDVVATNVASNNNANNTSATSRFLSRFKGLGGGASPPSP
                     IKIKSTEMALGLIGRTTPEPTGTAGPPPKQQRDRPPRTQEEVQYGMGWSDRPIDQNVK
                     SWEELDTTVKEEILDNHKEWFDAGGLGPCTMPPTYERVRDDSPPGEQVKWSARDGVNI
                     GVERLTTVSGPEWNLCPLPPIDLRNMEPASEPTIGDMIEFYEGHIYHYSIYIGQGKTV
                     GVHSPQAAFSVARVTIQPIAAWWRVCYIPQPKHRLSYDQLKELENEPWPYAAITNNCF
                     EFCCQVMNLEDTWLQRRLITSGRFHHPTQSWSQQTPEFQQDSKLELVRDAILAAVNGL
                     VSQPFKNFLGKLKPLNVLNILSNCDWTFMGVVEMVILLLELFGVFWNPPDVSNFIASL
                     LPDFHLQGPEDLARDLVPVILGGIGLAIGFTRDKVTKVMKSAVDGLRAATQLGQYGLE
                     IFSLLKKYFFGGDQTERTLKGIEAAVIDMEVLSSTSVTQLVRDKQAAKAYMNILDNEE
                     EKARKLSAKNADPHVISSTNALISRISMARSALAKAQAEMTSRMRPVVIMMCGPPGIG
                     KTKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKIQDDCNK
                     LQAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVY
                     CSAPEVEQIRRVSPGDTSALKDCFKPDFSHLKMELAPQGGFDNQGNTPFGKGTMKPTT
                     INRLLIQAVALTMERQDEFQLQGKMYDFDDDRVSAFTTMARDNGLGILSMAGLGKKLR
                     GVTTMEGLKNALKGYKINACTIKWQAKVYSLESDGNSVNIKEERNVLTQQQQSVCAAS
                     VALTRLRAARAVAYASCIQSAITSILQIAGSALVVNRAVKRMFGTRTATLSLEGPPRE
                     HKCRVHMAKAAGKGPIGHDDVVEKYGLCETEEDEEVAHAEIPSATMEGKNKGKNKKGR
                     GRRNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDG
                     GIGETEMEIRHRVFYKSKSRKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDER
                     EVDYNEKISFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSI
                     AIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIA
                     SMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKS
                     GNTVVCAVQASEGETTLEGGDKGHYAGHEIIKHGCGPALSTKTKFWKSSPEPLPPGVY
                     EPAYLGGRDPRVSGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSSLEQVMD
                     TPVPWSYSDACQSLDKTTSSGFPYHRRKNDDWNGTTFVRELGEQAAHANNMYEQAKSM
                     KPMYTAALKDELVKPEKVYQKVKKRLLWGADLGTVVRAARAFGPFCDAIKSHTIKLPI
                     KVGMNSIEDGPLIYAEHSKYKYHFDADYTAWDSTQNRQIMTESFSIMCRLTASPELAS
                     VVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDV
                     IQSMSYFSFYGDDEIVSTDIEFDPAKLTQVLREYGLKPTRPDKSEGPIIVRKNVDGLV
                     FLRRTISRDAAGFQGRLDRASIERQIYWTRGPNHSDPFETLVPHQQRKVQLISLLGEA
                     SLHGEKFYRKISSKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVN
                     DDGV"
     CDS             5355..6995
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ACU56258.1"
                     /translation="MMMASKDAPQSADGASGAGQLVPEVNTADPLPMEPVAGPTTAVA
                     TAGQVNMIDPWIVNNFVQSPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLSQMYNG
                     WVGNMRVRILLAGNAFSAGKIIVCCVPPGFTSSSLTIAQATLFPHVIADVRTLEPIEM
                     PLEDVRNVLYHTNDNQPTMRLVCMLYTPLRTGGGSGNSDSFVVAGRVLTAPSSDFSFL
                     FLVPPTIEQKTRAFTVPNIPLQTLSNSRFPSLIQGMILSPDASQVVQFQNGRCLIDGQ
                     LLGTTPATSGQLFRVRGKINQGARTLNLTEVDGKPFMAFDSPAPVGFPDFGKCDWHMR
                     ISKTPNNTSSGDPMRSVDVQTDVQGFVPHLGSIQFDEVFNHPTGDYIGTIEWISQPST
                     PPGTDINLWEIPDYGSSLSQAANLAPPVFPPGFGEALVYFVSAFPGPNNRSAPNDVPC
                     LLPQEYVTHFVSEQAPTMGDAALLHYVDPDTNRNLGEFKLYPGGYLTCVPNGVGAGPQ
                     QLPLNGVFLFVSWVSRFYQLKPVGTASTARGRLGVRRI"
     CDS             6995..7630
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="ACU56259.1"
                     /translation="MAQAIIGAIAASAAGSALGAGIQAGAEAALQSQRYQQDLALQRN
                     TFEHDKDMLSYQVQASNALLAKNLNTRYSMLIAGGLSNADASRAVAGAPVTQLIDWNG
                     TRVAAPRSDATTLRSGGFMAVPMPVQPKSKAPQSSGFSNPAYDMSTVSSRTSSWVQSQ
                     NSLRNVSPFHRQALQTVWVTPPGSTSSSSVSSTPYGVFNTDRMPLFANLRR"
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcaactaat gttgcaagca acaacaatgc
       61 taacaacact agtgctacat ctcgattttt atcgagattt aagggcttag gaggtggcgc
      121 aagcccccct agtcctataa aaattaaaag tacagaaatg gctctgggat taattggcag
      181 aacaactcca gaaccaacag ggaccgctgg tccaccgccc aaacaacaga gggaccgacc
      241 tcccagaact caggaggagg tccagtatgg tatgggatgg tctgacaggc ccattgatca
      301 aaacgttaaa tcatgggaag agcttgatac cacagtcaag gaagagatct tagacaacca
      361 caaagagtgg tttgacgctg gtggtttggg tccttgcaca atgcctccaa catatgaacg
      421 ggtcagggat gacagtccac ctggtgaaca ggttaaatgg tccgcgcgtg atggagtcaa
      481 cattggagtg gagcgcctca caacagtgag tggacccgag tggaaccttt gccctctacc
      541 ccccattgac ttaaggaaca tggagccagc cagtgaaccc actattggag atatgataga
      601 attctatgaa ggccacatct atcattactc catatacatt gggcaaggca aaacagtcgg
      661 tgtccattct ccacaggcag cgttctcagt ggctagggtg accatccagc ccatagccgc
      721 ttggtggaga gtttgttaca taccccaacc caagcacaga ctgagttacg accaactcaa
      781 ggaattagag aatgagccat ggccatatgc ggccataact aataattgtt ttgaattctg
      841 ctgtcaagtc atgaaccttg aggacacgtg gttacagagg cggttgatca cgtcgggtag
      901 attccaccac cccacccaat cgtggtcaca gcagacccct gagttccagc aagatagcaa
      961 gttagagttg gtcagggatg ctatattagc tgcagtgaat ggtcttgttt cgcagccctt
     1021 caagaatttc ttgggtaaac tcaaacctct caatgtgctc aacattttgt ctaattgtga
     1081 ttggaccttc atgggagtgg tggagatggt tatactatta cttgaactct ttggcgtgtt
     1141 ctggaacccg cctgatgtgt ccaattttat agcgtccctt ctccctgatt tccatcttca
     1201 aggacctgaa gacttggcac gagatctagt cccagtgatt cttggcggca taggattggc
     1261 catcgggttc accagagaca aagttacaaa ggttatgaag agtgctgtgg atggtcttcg
     1321 agctgctaca caactgggac aatatgggtt agaaatattc tcactactca agaagtattt
     1381 ctttgggggg gaccagactg agcgcaccct caaaggcatt gaggcggcag tcatagatat
     1441 ggaagtgttg tcctccacat cagtgacaca gctagtgaga gacaaacagg cagcaaaagc
     1501 ttatatgaac atcttggaca atgaagaaga gaaagccagg aagctctcag ctaaaaacgc
     1561 tgacccacat gtgatatcct caacaaatgc cctaatatcg cgtatttcca tggcacgatc
     1621 tgcattggcc aaggcccagg ctgagatgac cagtcgaatg agaccagttg ttattatgat
     1681 gtgtggcccg cctgggattg ggaagaccaa ggctgctgag cacctagcta agcgtctagc
     1741 taatgagatc agacctggtg gtaaggtggg gttggttccc cgtgaagctg tcgaccactg
     1801 ggacggttat catggtgagg aagtgatgct gtgggacgac tatggcatga caaaaataca
     1861 agatgactgt aataaactcc aagccattgc tgattcggcc ccactcacct taaattgtga
     1921 caggattgaa aacaaaggaa tgcagttcgt ttcagatgca atagtcatca ctaccaacgc
     1981 cccaggcccc gcccctgtgg actttgtcaa ccttggacca gtgtgtagac gggtcgactt
     2041 cttggtctac tgctctgccc cagaggtgga acagatacgg agggtcagcc ctggtgatac
     2101 atcagcactg aaagactgtt ttaagccaga cttctctcat ttaaaaatgg agctggctcc
     2161 acaaggtggg tttgacaatc aagggaacac accgtttggc aaaggcacca tgaagccaac
     2221 aaccattaac agacttctca tacaagctgt ggcccttacc atggaaaggc aggatgagtt
     2281 tcagttacag gggaagatgt atgactttga tgatgacagg gtgtcagcat tcaccaccat
     2341 ggcacgtgat aatggcctgg gcatcttgag catggcaggt ctgggcaaga agctacgtgg
     2401 tgttacaacg atggagggct taaagaatgc cctaaagggg tacaaaatca atgcgtgcac
     2461 aataaaatgg caggccaaag tgtactcact agaatcagat ggcaacagtg tcaacattaa
     2521 agaggagagg aacgtcttaa ctcagcaaca acagtcggtg tgtgccgcct ctgtcgcgct
     2581 cactcgtctt cgggctgcgc gcgcggtggc atacgcatcg tgcatccaat cggctataac
     2641 ttctatacta caaattgctg gctcagccct agtggtcaac agagcagtga agagaatgtt
     2701 tggcacgcgc acagccacct tgtccctaga gggccccccc agagaacaca aatgcagggt
     2761 ccacatggcc aaggccgcag gaaagggacc tattggccat gatgatgtgg tagaaaagta
     2821 tgggctttgc gaaacagagg aggacgaaga agtggcccac gctgaaatcc cttctgctac
     2881 catggagggc aagaacaaag ggaagaacaa gaaaggacgt ggtcggagga acaattacaa
     2941 cgccttctcc cgcagaggac tcaatgatga agagtacgaa gagtacaaga agatacgcga
     3001 ggagaaaggt ggcaactaca gcatacagga gtacctagaa gacagacaaa ggtatgaaga
     3061 agagctggca gaggttcaag caggtggaga tggaggaatt ggggaaactg aaatggaaat
     3121 ccgccacaga gtgttctaca aatccaagag cagaaagcat catcaggaag aacgacgcca
     3181 gctagggctg gtgacaggtt ccgacattcg gaagagaaaa ccaatcgact ggaccccacc
     3241 caagtcagca tgggcagatg atgagcgtga ggtggattac aatgagaaga tcagcttcga
     3301 ggcgcccccc actttatgga gtagagtgac aaagtttggg tctggatggg gtttctgggt
     3361 cagccctaca gtcttcataa ccacaacgca cgttatacca accagtgcaa aggagttctt
     3421 tggtgaaccc ctaaccagca tagctatcca cagggctggt gagttcactc tcttcaggtt
     3481 ttcaaagaaa attaggcctg atctcacagg tatgatcctt gaggagggtt gccccgaggg
     3541 cacggtgtgt tcagtactaa taaaaaggga ctctggtgaa ctactgccat tggccgtgag
     3601 gatgggcgca atagcatcaa tgcgcataca gggccgcctt gtccatgggc aatctggcat
     3661 gttactcacc ggggcaaatg ctaagggcat ggaccttgga accatcccag gggattgtgg
     3721 ggctccttat gtttataaga gggctaatga ctgggtggtc tgtggtgtac atgccgctgc
     3781 caccaagtca ggcaacaccg ttgtgtgcgc cgttcaggcc agtgaaggag aaactacgct
     3841 tgaaggcggt gacaaaggtc attatgctgg acatgaaata attaagcatg gttgtggacc
     3901 agctctatca accaaaacca aattctggaa atcatccccc gaaccactgc cccctggggt
     3961 ctacgagccc gcctacctcg ggggccggga ccctagggtg tctggcggtc cctcactcca
     4021 acaagtgttg cgggatcagt taaagccatt tgctgagcca cgaggacgta tgccagaacc
     4081 aggtctcttg gaggccgcag ttgagactgt gacttcatca ttagagcagg ttatggacac
     4141 tcccgttcct tggagctata gtgatgcgtg ccagtccctt gacaagacca ctagttctgg
     4201 tttcccctac catagaagga agaatgacga ctggaatggc accacctttg ttagggagtt
     4261 aggggagcag gcggcacacg ctaataacat gtatgagcag gctaaaagta tgaaacccat
     4321 gtacacggca gcacttaaag atgaactagt caaaccagag aaagtatacc agaaagtgaa
     4381 aaagcgcttg ttatggggag cagacttggg cacggtagtt cgggccgcac gggcttttgg
     4441 cccattctgt gatgctataa aatcccacac aatcaaattg cctatcaaag ttggaatgaa
     4501 ttcaattgag gatggaccac tgatctatgc agaacattcg aaatataagt accattttga
     4561 tgcagattac acagcttggg attcaactca aaataggcaa atcatgacag agtcattttc
     4621 aatcatgtgt cggctaactg catcacctga attagcttca gtggtggctc aagacttgct
     4681 cgcaccttca gagatggatg ttggtgacta cgtcataaga gtgaaggaag gtctcccatc
     4741 tggtttccca tgcacatcac aagttaatag cataaaccat tggttaataa ctctgtgtgc
     4801 cctttctgaa gtaactggtc tgtcgccaga tgttatccag tctatgtcat atttctcttt
     4861 ctatggtgat gatgaaatag tgtcaactga catagaattt gatccagcaa aactaacaca
     4921 agttctcaga gagtatggac ttaaacccac ccgccccgac aaaagcgagg gcccaataat
     4981 tgtaaggaag aatgtggatg gtttggtctt tttacgtcgc actatctccc gtgacgctgc
     5041 gggattccaa ggacgactgg accgagcatc cattgagaga caaatctact ggactagagg
     5101 acccaaccat tcagaccctt ttgagaccct ggtgccacac caacaaagga aggtccaact
     5161 aatatcatta ttgggcgagg cctcactgca tggtgaaaag ttttacagga agatttcaag
     5221 caaagttatc caggaaatta aaacaggggg tcttgaaatg tatgtgccag gatggcaagc
     5281 catgttccgt tggatgcggt tccatgacct tggtttgtgg acaggagatc gcaatctcct
     5341 gcccgaattt gtaaatgatg atggcgtcta aggacgcccc tcaaagcgct gatggcgcaa
     5401 gcggcgcagg tcaactggtg ccggaggtta atacagctga ccccttaccc atggaacccg
     5461 tggctgggcc aacaacagcc gtagccactg ctgggcaagt taatatgatt gatccctgga
     5521 ttgttaataa ttttgtccag tcaccgcaag gtgagtttac aatttcccct aataataccc
     5581 ccggtgatat tttgtttgat ctacaattag gtccacattt aaaccctttc ttgtcacatt
     5641 tgtcccaaat gtataatggc tgggttggaa acatgagagt taggattctc cttgctggga
     5701 atgcattctc agccggaaag attatagtct gttgtgtccc ccctggcttc acatcttcct
     5761 ctctcaccat agctcaggct acattgtttc cccatgtgat tgctgatgtg agaacccttg
     5821 aaccaataga aatgcccctc gaggacgtgc gcaatgtcct ctatcacacc aatgataatc
     5881 aaccaacaat gcggctggtg tgtatgctgt acacgccgct ccgcactggt ggggggtctg
     5941 gtaattctga ttcttttgta gttgctggca gggtgctcac ggcccctagt agcgacttca
     6001 gtttcttgtt ccttgtcccg cctaccatag aacagaagac tcgggctttt actgtgccca
     6061 atatcccctt gcaaacctta tccaattcta ggtttccttc cctcatccag gggatgattc
     6121 tgtcccctga cgcatctcaa gtggtccaat tccaaaatgg acgttgtctt atagatggtc
     6181 aactcctagg cactacaccc gccacatcag gacagctgtt cagagtgaga ggaaagataa
     6241 atcagggagc ccgcacactc aatctcacag aggtggatgg caagccattc atggcatttg
     6301 attcccctgc acctgtgggg ttccccgatt ttggaaaatg tgattggcac atgagaatca
     6361 gcaaaacccc aaataacaca agctcaggtg accctatgcg cagtgtcgac gtgcaaaccg
     6421 atgtgcaggg ttttgtgcca cacctgggaa gcatacagtt tgatgaagtg ttcaaccatc
     6481 ccacaggtga ctacattggc accattgaat ggatttccca gccatctaca ccccctggaa
     6541 cagatattaa tttatgggag atccccgatt atggatcatc cctctcccaa gcagctaatc
     6601 tggccccccc agtattcccc cctggatttg gtgaggctct tgtgtacttt gtttctgctt
     6661 ttccaggccc caacaaccgc tcagccccga atgatgtgcc ttgtctcctc cctcaagagt
     6721 acgtaaccca ctttgtcagt gaacaagccc caacgatggg tgacgcagct ttgctgcatt
     6781 atgtcgaccc tgataccaac agaaaccttg gggagttcaa gttataccct ggaggttacc
     6841 tcacctgtgt accaaacggg gtgggtgccg ggcctcaaca gcttcccctt aatggtgtct
     6901 ttctctttgt ctcttgggtg tctcgttttt atcagctcaa gcctgtggga acagccagta
     6961 cggcaagagg taggcttgga gtgcgccgta tataatggcc caagccatta taggagcaat
     7021 tgccgcgtca gctgctggct cagcattggg tgcgggcatc caggctggtg ccgaagctgc
     7081 gcttcagagt cagagatacc aacaagactt agccctgcaa aggaatacct ttgaacatga
     7141 taaagatatg ctttcctacc aggttcaggc aagtaatgcg ctcttagcaa agaatctcaa
     7201 tacccgctat tctatgctta ttgcaggagg tctttctaat gctgatgctt ctcgggctgt
     7261 tgctggagcc ccagtaacac aattgattga ttggaacggc actcgtgttg ctgcccccag
     7321 atcagatgca acaactctga ggtctggtgg ttttatggca gtccccatgc ctgttcaacc
     7381 caaatctaag gccccgcaat cctctgggtt ctctaatcct gcttatgata tgtccacagt
     7441 ttcctctagg acttcttcct gggtgcagtc acagaattcc ctgcgaaatg tgtcaccatt
     7501 ccataggcag gccctgcaga ctgtatgggt cactccacct gggtctactt cttcttcttc
     7561 tgtttcctca acaccttatg gtgtttttaa tacggatagg atgccgctat tcgcaaattt
     7621 gcggcgctaa tgttgtaata taatgcagca gtgggcacta tattcaattt ggtttaatta
     7681 gtaaataatt tggctattg
//