Typing tool

Complete norovirus genomes

FJ514242  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       FJ514242                7559 bp    RNA     linear   VRL 18-APR-2011
DEFINITION  Norovirus Hu/GII-4/CUK-3/2008/KR, complete genome.
ACCESSION   FJ514242
VERSION     FJ514242.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII-4/CUK-3/2008/KR
  ORGANISM  Norovirus Hu/GII-4/CUK-3/2008/KR
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Park,J.W., Lee,S.G., Lee,Y.M., Jheong,W.H., Ryu,S. and Paik,S.Y.
  TITLE     Full Sequence Analysis and Characterization of the South Korean
            Norovirus GII-4 Variant CUK-3
  JOURNAL   Virol. J. 8 (1), 167 (2011)
   PUBMED   21489302
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Lee,S.-G., Park,S.-W. and Paik,S.-Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-DEC-2008) Microbiology, College of Medicine, The
            Catholic University of Korea, Banpo4-dong, Seocho-gu, Seoul
            137-701, South Korea
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/GII-4/CUK-3/2008/KR"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII-4/CUK-3/2008/KR"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:587432"
                     /country="South Korea"
                     /collection_date="2008"
                     /note="genotype: GII-4"
     CDS             5..5104
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol; ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ACL36374.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGIPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGTDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1; ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ACL36375.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEVPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNVQNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ACL36376.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRNNPRTPTPARGSPSTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTNVSSPPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactgatca aaaagatccc tcctcccccg cccaacggag aggatgaagt
      241 agtggtttct tatagtgcca aagatggcgt ttccggttta cctgagcttt ccaccgtcag
      301 gcaaccggaa gaaaccaata cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactga ctggaacaat cctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgttgagc gaggtcttgt gctgggtgtg cacaaaccac cagctgccat
      481 tagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acactctcaa gaaattacac ggagaaacat tcccctacac
      601 agccttcgac aacaattgct atgccttttg ttgctgggtc ctggatctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caaattgaag aaggtagcta acatatttct
      781 gtgcaccctg tcttcgctat ttaccaggcc cataaaagac ataataggga agttaaggcc
      841 tctcaacatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt acaaggacct gaggaccttg cagtggaact
     1021 cgtccctgta gtaatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catctacctt gagagcttgt aaagatcttg gtgcgtatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtactggac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctatatga gaacccttga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgc tccctggtgc accgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaattgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcattattat cactactaac ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcatcgat ttcctcgtgt atgcagaagc
     1861 ccccgaggtc gaaaaggcaa agcgtgactt cccgggtcaa cctgacatgt ggaaaaacgc
     1921 ttttagttct gatttctcac acataaaatt ggcactggct ccacaaggtg gttttgataa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccactg gttccctcat
     2041 tgctcgagca tcagggctac tccatgagag gttggatgag tttgaactac agggcccagc
     2101 tcttaccacc ttcaactttg accgcaacaa agtgcttgct ttcaggcagc ttgctgctga
     2161 aaacaaatac gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcaaaac
     2221 catgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 tagtggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcacc tccgttcaga ccaacaatga gctggctggc gccctgcacc atctaaggtg
     2401 cgccagaatc aggtactatg tcaagtgtgt tcaggaggcc ctgtattcta tcatccagat
     2461 cgctggggct gcatttgtca ccacgcgcat catcaagcgc gtgaacattc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga ggccaccaac aaggacgggt gcccgaaacc
     2581 caaagatgat gaggagttcg tcatttcatc tgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agagaattag agaggaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca gaccaacaag
     2881 gaagcaacgc aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 gaggaaccca gaagacttca agcctaaggg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactacaat gaaaaactca gctttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggctca ggttggggct tctgggtctc ccccagcctg ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg aatccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcttggaa gaaggtgcgc ccgaaggcac cgtggtcaca ctactcatca aacggtctac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga aaatccaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gagggggaag ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gtggcaagga
     3721 ccccagagtc aaggatggcc cctcgttgca gcaagtcatg agggaccagc tgaaaccatt
     3781 tacagagcct aggggtaagc caccaaagcc aagtgtatta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacaggt gcacttaagg atgaattagt
     4081 caaaactgac aagatttatg gtaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgtcacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacaggt accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgctggcag ccgctctaga aatcatggtt aaattctccc cagaaccaca
     4381 tttggctcag gtagtagcag aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 cacaatatca atcaatgagg gccttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc actctccgaa gttacaaatt tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatacgggt tgaaaccaac
     4681 ccgccctgat aaaactgaag gacctcttgt tatttctgag gacttagatg gtttgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagacccat ctgaatcaat
     4861 gattccacac tctcaaagac ccatacaatt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacagta aaatcagcaa attagttatt gcagagctaa aagaaggtgg
     4981 tacggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagacct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtcggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtgattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatctga
     5341 atccctacct atcccatttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagtccca gccaggtcac tatgttcccc cacataatag
     5521 tggatgttag gcaattggaa cctgtgttga tccccttacc tgatgttagg aataacttct
     5581 accactataa tcagtcaaat gatcctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa taatgctggg gaggatgtct tcacagtctc ttgtcgagtt ctcacgaggc
     5701 catcccctga ttttgatttt atatttttgg tgccacctac agttgagtca agaactaaac
     5761 catttactgt cccaatccta actgttgaag aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaaatt gtttacgggt cccagcagtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggtt ctcgtaatta cacaatgaat ttggcttctc
     6001 taaattggaa caattatgac ccaacagaag aagttccagc ccctctagga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcactc aaaccacaaa gggagatggt tcgacccgtg
     6121 gccataaagc tacagtttac actgggagtg ccccctttac tccaaagctg ggcagtgttc
     6181 aattcagtac tgatacagaa aatgattttg aaactcacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggt agcaccaccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttattc aggtagaaat gtccaaaatg tacacctagc ccctgctgta gcccccactt
     6361 ttccgggtga acaacttctt ttctttaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatggattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggtagggtcc
     6541 tgtttgagtg caagcttcat aaatcaggct atgtcacagt ggctcacacc ggccagcatg
     6601 atttggtcat cccccccaat ggttatttta ggtttgattc ctgggttaat caattctaca
     6661 cacttgcccc catgggaaat ggaacggggc gcaggcgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttag ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaataac agaaaattgc agcaagcttc
     6841 cttccagttt agcagtaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acaggaaatg atgaaagtca aacaggcaat
     6961 gcttttagaa ggtggattct ctgaaacaga tgcagcccgt ggggcaatca acgcccctat
     7021 gacaaaggct ttggactgga gcgggacaag gtactgggcc cctgatgcta ggactacaac
     7081 atacaatgca ggccgttttt ccacccctca accttcgggg gcactgccag gaagaaacaa
     7141 tcccaggact cctacccccg ctcggggctc ccccagcaca tcttctaatg cttctactgc
     7201 tacttctata tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccaatgtc tcgagtcccc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatttg tcacctttca tgaggggggc tcacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa aggcaaaatt gattatcttt tcctttcttt agtgtcttt
//