Typing tool

Complete norovirus genomes

EU921389  GII.3
 GII.P21

Length: 7,547 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7495
LOCUS       EU921389                7547 bp ss-RNA     linear   VRL 12-JUN-2015
DEFINITION  Norovirus Hu/Pune/PC52/2007/India strain PC52 nonstructural
            polyprotein, capsid protein, and VP2 genes, complete cds.
ACCESSION   EU921389
VERSION     EU921389.2
KEYWORDS    .
SOURCE      Norovirus Hu/Pune/PC52/2007/India
  ORGANISM  Norovirus Hu/Pune/PC52/2007/India
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7547)
  AUTHORS   Chhabra,P., Dhongade,R.K., Kalrao,V.R., Bavdekar,A.R. and
            Chitambar,S.D.
  TITLE     Epidemiological, clinical, and molecular features of norovirus
            infections in western India
  JOURNAL   J. Med. Virol. 81 (5), 922-932 (2009)
   PUBMED   19319938
REFERENCE   2  (bases 1 to 7547)
  AUTHORS   Chhabra,P., Walimbe,A.M. and Chitambar,S.D.
  TITLE     Complete genome characterization of Genogroup II norovirus strains
            from India: Evidence of recombination in ORF2/3 overlap
  JOURNAL   Infect. Genet. Evol. 10 (7), 1101-1109 (2010)
   PUBMED   20633703
REFERENCE   3  (bases 1 to 7547)
  AUTHORS   Chhabra,P., Dhongade,R.K., Kalrao,V.R., Bavdekar,A.R. and
            Chitambar,S.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-2008) Rotavirus Department, National Institute of
            Virology, 20-A, Dr. Ambedkar Road, Pune, Maharashtra 411001, India
REFERENCE   4  (bases 1 to 7547)
  AUTHORS   Chhabra,P., Dhongade,R.K., Kalrao,V.R., Bavdekar,A.R. and
            Chitambar,S.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-AUG-2010) Rotavirus Department, National Institute of
            Virology, 20-A, Dr. Ambedkar Road, Pune, Maharashtra 411001, India
  REMARK    Sequence update by submitter
COMMENT     On Aug 3, 2010 this sequence version replaced EU921389.1.
FEATURES             Location/Qualifiers
     source          1..7547
                     /organism="Norovirus Hu/Pune/PC52/2007/India"
                     /mol_type="genomic RNA"
                     /strain="PC52"
                     /host="Homo sapiens"
                     /db_xref="taxon:585803"
                     /country="India"
     CDS             5..5104
                     /note="ORF1; contains NTPase, 3A-like protein, VPg,
                     protease, and RdRp"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ADK94753.1"
                     /translation="MKMASNDASAAAVANSNNDNAKSSSDGVFSNMAVTFKRALGARS
                     KQPPPRDKPPKPPRPPTPELVKAIPPPPPNGEDEPIISYNVKEGVSGLPELSTVTQLE
                     ESSTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLYWRPVYTPQYLISPDTLRKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDTKVKKVANVVLCALSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEKNELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDMEEEKARKLST
                     KSASPDIVGTINALLSRIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIASSLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDTFKPDFSHIKLTLAPQGGFDKNGNTPHGKGIMKTLTASSLVARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLVDTMRVGSQLKNVKTM
                     TELKQALKNISVKKCQLVYGGGTYTLESDGKGNVHVEKVNNTSVQTNNELSGALHHLR
                     CARIRYYVKCVQEALYSILQIAGAAFITTRIAKRMNIQNLWSKPQAEDLEETNNEEGC
                     PKPKNDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTVAARGGNTVICATQGNEGEAMLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTYAQACASLDKTTSSGHPYHMRKNDCW
                     NGETFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGTIKKRLLWGSDL
                     STMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTTKLK
                     EYGLKPTRPDKTEGPLIISEDLDGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6731
                     /note="structural protein; ORF2; VP1"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ACL31361.2"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFSLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKIDTTSGRFTPKLGSLEISTESDDFDQNKP
                     TRFTPVGIGVDHEADFQQWALPDYAGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPSQSQVALVRYINPDTGRVLFEAKLHKLGFITIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     CDS             6731..7495
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ADK94752.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVNAGANAINQTIDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPGATSTTSMSGGFTNQTVHRSTPNFKTNQAPKPTPSSGSSVRSNSTQITSLSS
                     HSSGSSRSSGSTVVNSIPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caacgcaaaa tcttcaagtg acggagtatt ttctaatatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggtctaaac agccgccccc gagggacaaa ccaccaaaac ccccaagacc
      181 acccacacca gaattggtta aagcaatccc ccctccccca cccaacgggg aggacgaacc
      241 aatcatttct tacaacgtca aagagggtgt ttctggtttg cctgaactct caactgtcac
      301 ccaactggaa gagagctcta cagcattcag cgttccccct cttagccaga gggagaacag
      361 agatgcaaag gaaccattga ctggaaccat cctggagatg tgggacgggg agatctacca
      421 ttatggctta tacgtggaac gaggattagt gctaggtgta cacaaaccac cagcagccat
      481 cagccttgct aaggttgagc tgaccccctt gtctttgtat tggagaccag tgtacacccc
      541 acagtacctc atttcccctg acactctcag aaagttgcat ggggagacgt tcccttatac
      601 agcctttgac aacaactgtt atgccttctg ctgttgggta cttgacttga acgattcatg
      661 gctgagtaga aggatgatac agaggacaac aggcttcttc cgaccctacc aggactggaa
      721 caggaaaccc ctccccacga tggatgacac caaagtgaaa aaggtggcca atgttgtcct
      781 ctgtgctctc tcatcattgt ttacaagacc aattaaggac attattggga agttgaaacc
      841 cctaaacatc ctcaacatcc tagccacatg tgattggact tttgcaggca tagtggaatc
      901 cctgatcctt ttggctgaac tgtttggagt tttctggaca cccccagatg tgtctgcaat
      961 gatcgctccc ttactgggtg attatgagct gcagggaccc gaggacctcg ctgtggaact
     1021 cgtacccgta gtaatgggag ggataggttt ggtgctggga ttcaccaaag agaaaatcgg
     1081 caaaatgctt tcatctgctg cttcaaccct gagggcatgc aaagatctcg gtgcatatgg
     1141 gttggagatc ctcaagttgg tcatgaaatg gtttttccca aagaaagaag agaaaaacga
     1201 attggcaatg gtgagatcca tcgaggatgc agtgctagat cttgaggcca ttgagaacaa
     1261 ccatatgact gctctactca aggataaaga cagccttgca acctacatga ggacccttga
     1321 catggaggag gagaaggcga ggaaactttc caccaagtct gcctcgccgg atattgtggg
     1381 cacgataaac gccctactgt caaggattgc tgctgcccgg tctctagtgc acagggctaa
     1441 ggaggagctg tcaagcaggc cccgaccggt cgttgtaatg atttcaggga gaccaggcat
     1501 agggaaaacc catctagcta gagagttggc aaagaagatc gcctcctcac tcacaggtga
     1561 ccagagggtg ggtcttatcc cacgcaacgg ggtcgaccac tgggatgcat acaaaggtga
     1621 aagagtcgtt ctctgggacg actacgggat gagtaaccct atccacgacg ccctcagact
     1681 ccaggagctc gctgatacct gtcctcttac actcaactgt gacaggattg agaacaaagg
     1741 caaagtcttt gacagtgacg ccataataat aaccaccaat ttggccaacc cagcgccact
     1801 ggattacgtc aactttgaag cctgctcaag acgcatagac ttcctcgtct atgctgatgc
     1861 ccctgaagtt gagaaggcta aacgggactt cccaggccaa ccagacatgt ggaaagacac
     1921 ctttaaacct gacttctcac acataaaact gacattagcc ccgcaaggag gttttgacaa
     1981 gaatggtaac actcctcatg ggaagggtat catgaagacc ctcactgcca gttccctcgt
     2041 tgcccgagca tcagggctcc tccacgagag attagacgaa tatgagctgc agggcccaac
     2101 tcccacaaca ttcaacttcg accgcaacaa ggtgcttgct tttaggcagc ttgctgctga
     2161 aaacaagtac ggtcttgttg acacaatgag ggtcggatca cagctcaaga atgtcaaaac
     2221 tatgacagaa ctcaagcagg ctctcaagaa catctcagtc aagaaatgtc agcttgtgta
     2281 tggtgggggc acgtacacac ttgaatctga tggcaaaggc aatgtgcatg tcgagaaggt
     2341 gaacaacacc agtgtgcaaa ctaacaacga gctctccggg gctttgcacc atctcaggtg
     2401 tgccagaatc aggtactatg ttaagtgtgt ccaggaagct ctctactcca tcttgcaaat
     2461 tgctggggct gcattcatta ccacgcgcat tgcaaagcgc atgaacatac aaaacctctg
     2521 gtccaaacca caagcagaag atctggagga gactaacaat gaggagggtt gtccaaaacc
     2581 taaaaatgat gaggagtttg tcatctcctc tgatgacatc aaaaccgagg gcaagaaagg
     2641 aaagaacaag actggccgtg gcaagaagca tacagccttt tccagcaaag gactcagtga
     2701 tgaggagtac gatgaatata aaagaatcag ggaagagaga aatggcaagt actccataga
     2761 ggaataccta caggacagag acaaatacta tgaggaggtg gccatagcca gggcaactga
     2821 ggaagacttc tgtgaagaag aggaggcaaa aatccggcaa aggatattta gaccaacaag
     2881 gaaacaacgc aaagaggaaa gggcctctct tggtttggtt acaggttctg agatcaggaa
     2941 gagaaaccca gatgacttca agcccaaagg gaaactatgg gccgatgatg acaggagtgt
     3001 tgactacaat gagaaactta gtttcgaggc tccaccaagc atttggtcac gaatagtcaa
     3061 ctttggctca gggtggggct tttgggtctc gcccagcctc ttcataacat caacccatgt
     3121 cattccccaa ggcgcacagg agttctttgg agtgcccatc aaacaaatac aaattcacaa
     3181 gtcaggtgag ttctgccggc ttaggttccc aaaaccaatc aggacagatg tcacaggcat
     3241 gatcttggag gaaggtgctc cagaaggcac tgttgccaca cttctcatca agagaccaac
     3301 tggagaactc atgcccttgg cagccagaat gggcacccac gcgaccatga aaattcaggg
     3361 tcgcactgtt ggtggtcaga tgggcatgtt actcacaggg tctaacgcta agagcatgga
     3421 cttgggtaca actcctggcg attgtggttg tccctatatc tacaagagag ggaacgacta
     3481 cgtggtcatt ggagttcaca ctgtcgccgc tcgtggggga aacaccgtca tctgtgcaac
     3541 ccaaggaaac gagggtgagg ccatgctaga aggtggtgac aacaagggaa cttattgtgg
     3601 agcaccaata ttaggcccag ggaatgcccc caaactcagc accaaaacca aattctggag
     3661 gtcttccacc acccccctgc cacccggaac ctatgagcca gcttatctgg gtggcaagga
     3721 ccctagagtg aaaggtggcc cctcactgca acaggttatg agggaccaac taaaaccatt
     3781 cactgagccc agaggcaaac cacccaaacc aagtgtgcta gaagccgcca agaagactat
     3841 aatcaatgtg cttgaacaaa caatagaccc acctcaaaaa tggacatacg cacaggcgtg
     3901 tgcatcacta gacaagacca cttccagcgg ccacccttac cacatgcgga agaacgattg
     3961 ctggaatggg gagactttca caggaaaact ggcagaccaa gcatcaaagg ctaacctaat
     4021 gtttgaggaa ggaaagaaca tgaccccagt atacacagga gctctgaaag atgagctagt
     4081 caagactgat aagatctatg gaacaatcaa gaagagactc ctgtggggtt cagacctatc
     4141 aaccatgata cggtgtgcac gagccttcgg tgggctaatg gacgaactca aggcccattg
     4201 cgtcacacta ccagtcaggg ttggtatgaa catgaatgag gatggaccca taatatttga
     4261 gaaacattcc agatacaaat accattatga tgcagattac tcccgttggg actcaacaca
     4321 acaaagagca gtgctggctg cagccctgga aataatggtc aaattctcac cagaacccca
     4381 tctggcccaa gtggttgctg aagacctctt gtcccccagt gtgatggatg tgggtgactt
     4441 caagatatca atcaacgagg gattaccctc tggtgttccc tgcacctcac aatggaactc
     4501 cattgcccac tggctcctca cactatgtgc actgtctgaa gtcacagacc tgtcccctga
     4561 catcatccag gcaaattccc tgttctcctt ttatggtgat gatgaaatag tgagcacaga
     4621 tattaaactg gacccagaga aattaacaac aaaattgaag gaatacgggc taaaaccaac
     4681 ccgtcctgac aaaacagaag gacccttaat tatctctgaa gatttggatg gcctgacctt
     4741 cttacggaga acggtgaccc gtgatccggc cgggtggttt ggcaaactgg accaaagttc
     4801 aatactcagg cagatgtact ggaccagggg accaaaccat gaggacccct tcgaaacaat
     4861 gataccacac tcccaaagac ccatacaact gatgtcatta ttgggtgaag ctgcgttgca
     4921 tggtccatca ttctacagta aaatcagcaa attggtcatc tcagaattga aagagggtgg
     4981 aatggatttt tacgtgccca gacaagaacc aatgttcagg tggatgagat tctcagattt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctaat gatggtgccg ccggcctcgt cccagagatc aacaatgagg
     5161 caatggcgct agagccagtg gcgggtgcag cgatagcagc acccctcact ggtcagcaaa
     5221 atataattga tccctggatt atgaataatt ttgtgcaagc acctggtggt gagtttacag
     5281 tatcccctag aaattcccct ggtgaagttc ttcttaattt ggaattgggc ccagaaataa
     5341 atccctattt ggcccatctt gctagaatgt ataatggtta tgcaggtgga tttgaagtgc
     5401 aggtggtcct agctggaaat gcgtttacag caggaaagat aatctttgca gctattcccc
     5461 ctaattttcc aattgataat ctaagtgcag cacagatcac aatgtgtcca catgtgattg
     5521 tggatgtcag acagctggaa ccagtcaacc tcccaatgcc tgacgttcgt aacaacttct
     5581 ttcattacaa tcaagggtct gattcgagat tgcgcctaat tgcaatgctg tatacacctc
     5641 ttagggcaaa taattctggg gatgatgttt ttactgtgtc ttgcagagtg ctaactagac
     5701 ctagtcctga cttctcattt aatttccttg tgccacctac tgtggagtca aagacaaaac
     5761 ccttttccct ccctattctg actatctctg aaatgtctaa ttctaggttc ccagtaccaa
     5821 ttgattctct gcacaccagc cctactgaga acattgttgt ccagtgtcag aatggacgcg
     5881 tcacccttga tggtgagttg atgggcacca cccaactctt acctagccaa atctgtgctt
     5941 tcaggggcgt gctcaccaga tcaacaagca gggccagtga ccaggccgat acagcaaccc
     6001 ctagattgtt taattattat tggcatatac agttggataa tctaaatgga actccttatg
     6061 accctgcaga agatatacca ggccccctag ggacaccaga ttttcggggc aaagtctttg
     6121 gcgtggccag ccagagaaat cctgatagca cgactagggc acatgaagca aagatagaca
     6181 caacatctgg ccgtttcacc ccaaaactag gctcattaga gatttccact gagtctgatg
     6241 attttgatca aaacaaacca acaagattca ccccagttgg cattggggtt gaccatgagg
     6301 cagactttca acaatgggct cttcccgact atgctggcca gttcacccac aacatgaact
     6361 tagccccagc tgttgctccc aactttcctg gtgagcagct ccttttcttc cgctcacagt
     6421 tgccatcttc tggtgggcga tccaacggga ttctagactg cctggtcccc caagaatggg
     6481 tacagcactt ctaccaagaa tcagccccct cccaatctca agtggccctg gttaggtata
     6541 tcaaccctga cactggtaga gtgttatttg aggccaagct gcacaaatta ggtttcataa
     6601 ctatagccaa gaatggtgac tctccaataa ctgtccctcc aaatggatac tttaggtttg
     6661 aatcttgggt gaaccccttt tatacacttg cccccatggg aactgggaat gggcgtagaa
     6721 ggattcaata atggctggag cttttatagc aggattggct ggtgacatgc tcacaaatac
     6781 tgtaggatct ttagttaatg caggggctaa tgccattaat caaacaattg attttgaaaa
     6841 taataaatat ttgcaaaatg cctcttttaa tcatgataag gagatgttga acgcacaaat
     6901 tgaggcaaca aagagattac aggctgacat gattgctatc aaacaagggg ttttgaccgc
     6961 tggcggcttc tcccctactg atgcagcccg cggggcaatc aatgccccca tgacaaaagt
     7021 cctagattgg aatggaacga gatactgggc accaggtgcc acctccacaa cctcgatgtc
     7081 gggtggcttc acaaatcaaa ctgtgcacag atccacacca aattttaaaa cgaaccaggc
     7141 ccccaaaccc acacccagca gtgggtcttc agtgaggtca aattcaaccc aaatcactag
     7201 cctgagttca cactcgtccg ggtcgtctcg atccagcggg tctacagttg tcaactcaat
     7261 accatcctct aacaggacta gggactgggt caaccaacaa aattttaatt tggaaccaca
     7321 catgcctgga tctcttagga cagcttttgt cactccacca tctagtacag cctctagctc
     7381 aggcacagtc tcaactgtgc ccaaaaatgt tttggactcc tggacatctg cgtttaacac
     7441 gcgcagacaa ccgctattcg cacaccttcg cagaaggggg gagtcgaatg tttagtgaaa
     7501 agattatttt aaatttgatt taaattggat ttgatttgga atctttt
//