Typing tool

Complete norovirus genomes

EU921344  GII.4 Hunter
 GII.P4 Hunter

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       EU921344                7559 bp ss-RNA     linear   VRL 12-JUN-2015
DEFINITION  Norovirus Hu/Pune/PC15/2006/India strain PC15 nonstructural
            polyprotein, capsid protein, and VP2 genes, complete cds.
ACCESSION   EU921344
VERSION     EU921344.2
KEYWORDS    .
SOURCE      Norovirus Hu/Pune/PC15/2006/India
  ORGANISM  Norovirus Hu/Pune/PC15/2006/India
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Chhabra,P., Dhongade,R.K., Kalrao,V.R., Bavdekar,A.R. and
            Chitambar,S.D.
  TITLE     Epidemiological, clinical, and molecular features of norovirus
            infections in western India
  JOURNAL   J. Med. Virol. 81 (5), 922-932 (2009)
   PUBMED   19319938
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Chhabra,P., Walimbe,A.M. and Chitambar,S.D.
  TITLE     Complete genome characterization of Genogroup II norovirus strains
            from India: Evidence of recombination in ORF2/3 overlap
  JOURNAL   Infect. Genet. Evol. 10 (7), 1101-1109 (2010)
   PUBMED   20633703
REFERENCE   3  (bases 1 to 7559)
  AUTHORS   Chhabra,P., Dhongade,R.K., Kalrao,V.R., Bavdekar,A.R. and
            Chitambar,S.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-2008) Rotavirus Department, National Institute of
            Virology, 20-A, Dr. Ambedkar Road, Pune, Maharashtra 411001, India
REFERENCE   4  (bases 1 to 7559)
  AUTHORS   Chhabra,P., Dhongade,R.K., Kalrao,V.R., Bavdekar,A.R. and
            Chitambar,S.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-AUG-2010) Rotavirus Department, National Institute of
            Virology, 20-A, Dr. Ambedkar Road, Pune, Maharashtra 411001, India
  REMARK    Sequence update by submitter
COMMENT     On Aug 3, 2010 this sequence version replaced EU921344.1.
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/Pune/PC15/2006/India"
                     /mol_type="genomic RNA"
                     /strain="PC15"
                     /host="Homo sapiens"
                     /db_xref="taxon:585766"
                     /country="India"
     CDS             5..5104
                     /note="ORF1; contains NTPase, 3A-like protein, VPg,
                     protease, and RdRp"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ADK94749.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKNVPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLFWRPVYTPQYLISPDALKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLADLFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLAMKWFFP
                     KKEEANELAIVRSIEDAVLDLEGIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGRQLKDVRTM
                     PELKQALKNISIKKCQIVHNGCTYTLESDGKGNVKVDRVQSASVQTNNELTGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEETTSKGGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKTGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKQTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPVIFEKHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="structural protein; ORF2; VP1"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ACL31316.2"
                     /translation="MKMASSDATPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGTQNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGMP
                     TQTTRGDGSTRGHKATVSTGSVHFTPKLGSVQFSTDTSNDFETGQNTRFTPVGVVQDG
                     STTHQNEPQQWVLPNYSGRDSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQESAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     CDS             6707..7513
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ADK94748.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAVN
                     APMTKSLDWSGTRYWAPDARTTTYNAGRFSTPQPSGASPGRTNLRATVPARGSSSTPS
                     NASTATSVYSNQTASTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSNQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaagc agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaatgtccc ccctcccccg cccaacggag aggatgaaat
      241 agtagtttct tatagtgtca aagatggtgt ctccggtttg cctgatcttt ccaccgtcag
      301 gcaaccggaa gaatctaaca cggcattcag tgtccctcca ctcaatcaga gggagaatag
      361 ggatgctaag gagccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgtggagc gaggtcttgt actaggtgtg cacaaaccac cagctgccat
      481 tagtctcgct agggtcgaac taacaccact ctccttgttc tggaggcctg tgtatactcc
      541 tcagtacctc atctctccag acgctctcaa gaaattacac ggagagacat tcccctacac
      601 agcctttgac aacaattgct atgccttttg ttgctgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc aggccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caagttaaag aaagtagcta acatattcct
      781 gtgtgctctg tcttcgctat tcactaggcc cataaaagat ataataggga agctaaggcc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagatc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg attacgagct acaaggacct gaggaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg ccatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctata gtgagatcca tcgaggatgc agtcctggat ctcgagggaa ttgaaaacaa
     1261 ccatatgacc accttgctta aagacaaaga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgc tctctggtgc atcgagcgaa
     1441 ggaggaactt tccagcagac caagacctgt agtgttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaacccc atccacgatg ccctcaggtt
     1681 gcaagaactc gctgacactt gccccctcac cctaaactgt gacaggattg agaataaagg
     1741 aaaggttttt gacagcgatg tcatcattat caccactaat ctggctaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gaaaaggcga agcgcgactt cccaggccaa cccgacatgt ggaagaacgc
     1921 cttcagttct gacttctcac acataaaact aacattggct ccacagggtg gcttcgacaa
     1981 gaacgggaac actccacacg gaaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgaa tttgaattac agggcccaac
     2101 tctcaccacc ttcaactttg atcgcaataa agtgctcgcc tttagacaac ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgag agttgggagg cagctcaagg atgtcagaac
     2221 aatgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agatagtgca
     2281 taatggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcaaagcgcc tccgtgcaaa ccaacaatga gctgactggc gccctgcacc atctaaggtg
     2401 cgccagaata agatactatg ttaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa acacagagga gactaccagc aagggcgggt gtccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc cgacgacatc aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgcg gcaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaggacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtttagtt acaggttctg aaattaggaa
     2941 aagaaatcca gatgatttta aacccaaggg gaagctgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggat tctgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacataa
     3181 gacaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcac ccgagggcac cgtggtcaca ctactcatca aaaggtccac
     3301 tggtgaactc atgcccctag cagctaggat ggggacccac gcaaccatga aaatccaagg
     3361 acgcactgtt gggggtcaaa tgggcatgct tctgacagga tccaacgcca agagcatgga
     3421 cctgggtacc acaccaggtg attgtggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgctac
     3541 ccaggggagt gagggagagg ctacacttga aggtggtgat aataaaggga catactgtgg
     3601 tgcaccaatc ctaggtccag ggagtgctcc aaaacttagc accaagacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gtggcaagga
     3721 ccccagagtc aagggtggcc cctcactgca gcaagttatg agggatcagt tgaagccatt
     3781 tacagagccc aggggcaagc caccaaagcc aagtgtgttg gaagctgcca agcaaaccat
     3841 tatcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcattcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttccagtgg ccatccgcat cacatgcgga aaaacgactg
     3961 ctggaatggg gagtccttca caggcaagct agcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacagct gcgcttaagg atgaattagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aaacacactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggccccg tcatcttcga
     4261 gaagcattcc aggtacacat accactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttagcag cagctctaga aatcatggtt aaattctccc cagaaccaca
     4381 tttggctcag gtagtcgcag aagaccttct ctctcctagc gtggtggacg tgggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gttacaaact tgtctcctga
     4561 caccatacag gctaattccc tcttctcctt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaga agttgacagc aaagctcagg gaatatgggt taaaaccaac
     4681 ccgccctgac aaaactgaag gaccccttgt catctctgaa gacttgaatg gcctgacttt
     4741 cctgcggagg actgtgaccc gcgacccagc tggttggttt ggaaaattgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ttccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaaggc ccatacaatt gatgtcccta ctgggggagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccac cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg cgattgcagc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatat tatggagcgc gcccttgggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggata tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc catataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccttacc tgatgttagg aacaatttct
     5581 atcattacaa tcaatcaaat gaccccacca tcaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa caatgctggg gacgatgtct tcacagtctc ttgccgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttgg tgccacccac agttgaatca agaactaaac
     5761 cattctctgt cccaatctta actgttgagg agatgaccaa ttcaagattc cctattcctt
     5821 tggaaaagtt gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggtacta cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggca ctcaaaatta cacaatgaat ctggcctccc
     6001 aaaattggaa caactacgac ccaacagaag aaatcccagc ccctctggga accccagatt
     6061 ttgtaggaaa gatccaaggc atgcccaccc aaactacaag gggggatggc tcgacccgcg
     6121 gtcataaagc cacagtgagc actggaagtg tccacttcac cccaaagctg ggcagtgttc
     6181 aattttccac tgacacaagc aatgactttg aaactggcca aaacacgaga ttcaccccag
     6241 tcggtgtcgt ccaggatggt agtaccaccc accaaaatga accccaacaa tgggtgctcc
     6301 caaactattc aggtagagac agtcacaatg tacatctagc ccctgccgtg gcccccactt
     6361 ttccgggtga gcaacttctt ttctttaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatgaattt ggattgccta ctccctcagg agtgggtgca gcacttctac caagagtcag
     6481 ctccagcaca atctgatgtg gcactgctga gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg caagcttcat aaatcaggct atgtaacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggctatttta gatttgattc ctgggtcaac caattctaca
     6661 cacttgcccc catgggaaat ggagcggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctgggctt ggctctttaa tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgagtt tgaaaataac agaaaattgc aacaagcctc
     6841 tttccaattt agcagcaacc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaggcaat
     6961 gctcctagag ggtgggttct ctgagacaga tgcagcccgt ggggcagtca acgcccccat
     7021 gacaaagtct ttggactgga gcggaacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccacccctca accctcgggg gcatcgccag gaagaactaa
     7141 tctcagggct actgtccccg ctcggggctc ctccagcaca ccttctaatg cttccactgc
     7201 tacttctgtg tactcaaatc aaactgcttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 caggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagtagatcc tctaaccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgca ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattctttcc ttttctttag tgtcttttt
//