Typing tool

Complete norovirus genomes

EU310927  GII.4 Yerseke
 GII.P4 US95

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       EU310927                7559 bp    RNA     linear   VRL 24-DEC-2007
DEFINITION  Norovirus Hu/Houston/TCH186/2002/US, complete genome.
ACCESSION   EU310927
VERSION     EU310927.1
KEYWORDS    .
SOURCE      Norovirus Hu/Houston/TCH186/2002/US
  ORGANISM  Norovirus Hu/Houston/TCH186/2002/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Larsson,M.M., Rydell,G.E., Grahn,A., Rodriguez-Diaz,J.,
            Akerlind,B., Hutson,A.M., Estes,M.K., Larson,G. and Svensson,L.
  TITLE     Antibody prevalence and titer to norovirus (genogroup II) correlate
            with secretor (FUT2) but not with ABO phenotype or Lewis (FUT3)
            genotype
  JOURNAL   J. Infect. Dis. 194 (10), 1422-1427 (2006)
   PUBMED   17054072
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Hutson,A.M., Chandrasekaran,A., Neill,F.H., Estes,M.K. and
            Atmar,R.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-NOV-2007) Molecular Virology & Microbiology, Baylor
            College of Medicine, 1 Baylor Plaza, Houston, TX 77030, USA
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/Houston/TCH186/2002/US"
                     /mol_type="genomic RNA"
                     /strain="Hu/Houston/TCH186/2002/US"
                     /host="Homo sapiens"
                     /db_xref="taxon:489822"
                     /country="USA"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1; encodes non-structural proteins"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ABY27559.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEIVVSYSVKDGVSGLPELSTVRQPE
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSASVQTNNELTGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEEATNKDGC
                     PKPRDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTKKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWD
                     STQQRAVLAAALEVMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSHFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major capsid protein; ORF2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ABY27560.1"
                     /translation="MKMASSDASPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGTHDYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRGDGSTRGHKATVSTGSVHFTPKLGSVQFTTDTNNDLETGQNTKFTPVGVVQDG
                     NSAHQNEPQQWVLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVLHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGPHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     CDS             6707..7513
                     /note="minor capsid protein; ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ABY27561.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQGMMEVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRINPRAPAPAQGSSSTPS
                     STSTATSVYSNQTVSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7514..7559
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc ccctcccccg cctaacggag aggatgagat
      241 agtggtttct tatagtgtca aagatggtgt ttccggtttg cctgagcttt ccaccgtcag
      301 gcaaccggaa gaagctaata cggccttcag tgtcccccca ctcaatcaga gggagaatag
      361 agatgctaag gagccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgtggagc gaggtcttgt actaggtgtg cacaagccac cagctgccat
      481 tagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtatactcc
      541 tcagtacctc atctctccag acactctcaa gaaattacat ggagaaacgt ttccctacac
      601 agcctttgac aacaattgct atgccttttg ttgctgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcta acatattcct
      781 gtgtgccctg tcttcgctat tcaccaggcc cataaaagac ataataggga agctaaggcc
      841 tcttaacatc ctcaacatct tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg attacgagtt gcaaggacct gaagaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggtct ggtgctggga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagggcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtgttggac ctcgaggcaa tcgaaaacaa
     1261 ccatatgacc accttgctca aggacaaaga tagtctggca acctacatga gaacccttga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttttgg cgagaatcgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggaactt tccagcagac caagacctgt agtcttaatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggtt
     1681 gcaagaactc gctgacactt gccccctcac tctaaactgt gacaggattg agaataaagg
     1741 aaaggttttt gacagcgatg tcatcattat cactactaat ctagctaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgtatcgat ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga agcgtgactt cccaggccaa cctgacatgt ggaagaacgc
     1921 ttttagttct gatttctcac acataaaact gacactggct ccacagggtg gctttgataa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcactaccg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgaa tttgaactac agggcccaac
     2101 tctcaccacc ttcaactttg atcgcaacaa agtgcttgcc tttaggcagc ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcagaac
     2221 catgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agatagtgta
     2281 cagtggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcgcc tccgtgcaga ccaacaatga gctgactggc gccctgcacc acctaaggtg
     2401 cgccagaatc aggtactatg tcaggtgtgt tcaggaggcc ctgtattcca tcatccagat
     2461 tgctggggcc gcatttgtca ccacgcgcat cgtcaagcgt atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa acacagagga ggctaccaac aaggacgggt gcccaaaacc
     2581 cagagatgat gaggagttcg tcatttcgtc cgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag accggccgtg gcaagaaaca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaggagtac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca ggccaacaaa
     2881 gaaacaacgc aaggaagaaa gagcttctct cggtttggtc acaggttctg aaattaggaa
     2941 aagaaaccca gatgatttca agcccaaggg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtctc ccccagtctg ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg aattctttgg agtccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgaa ttctgtcgct tgagattccc gaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggcac cgtggtcaca ctactcatca aaaggtctac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga aaattcaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaatgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 tcaggggagt gagggggagg ctacacttga aggtggtgac agtaagggaa catattgtgg
     3601 tgcgccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccccagagtc aagggtggcc cttcgttgca gcaagtcatg agggatcagc tgaaaccatt
     3781 tacagagccc aggggtaagc caccaaagcc aagtgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgaccc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctc gacaagacca cttctagtgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaagaa gggaagaaca tgaccccagt ctacacaggt gcgcttaagg atgaattagt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggtt cggatttagc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgttacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcattcc aggtacagat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgttggcag ctgctctaga agtcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtagtcgcag aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 cacaatatcg atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gttacaaatt tgtcccctga
     4561 catcatacag gctaattccc acttctcctt ttatggtgat gacgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaaacttaag gaatatggat tgaaaccaac
     4681 ccgccctgat aagactgaag gacctcttgt tatctctgaa gacttaaatg gtctgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggactagagg ccccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt gatgtcccta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 tatggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagcttt gtgaatgaag atggcgtcga
     5101 gtgacgccag cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg caattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cctgatctga
     5341 atccctacct ttctcatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaattct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc catataatag
     5521 tagatgttag gcaactggaa cctgtgttga ttcccttacc tgatgtcagg aataatttct
     5581 atcactataa tcagtcaaat gaccccacca ttaaactgat agcaatgctg tacacaccac
     5641 ttagggctaa taatgctggg gatgatgtct tcacagtctc ttgccgagtc ctcacgaggc
     5701 catcccctga ttttgatttt atatttttgg tgccacccac agttgagtca agaaccaaac
     5761 cattcaccgt cccaatttta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagtt gttcacgggt cccagcggtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggtacta cccaactgtc tcctgttaac atctgcactt
     5941 tcagagggga tgtcacccac attgcaggca ctcatgatta tacaatgaat ttggcttctc
     6001 aaaattggaa caattacgac ccaacagaag aaatcccagc ccctctggga actccagatt
     6061 tcgtgggaaa gatccaaggc gtgctcactc aaaccacaag gggagatggc tcgacccgtg
     6121 gccacaaagc cacagtgagc actgggagtg tccactttac tccaaagctg ggcagtgttc
     6181 aattcaccac tgacacaaac aatgatcttg aaactggcca aaacacgaaa ttcaccccag
     6241 tcggtgtcgt ccaggatggt aatagtgccc accaaaatga accccaacaa tgggtgctcc
     6301 caaattactc aggtagaact ggccataatg tacacctagc ccctgccgta gcccccactt
     6361 ttccgggtga gcaacttctc ttcttcaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatgaattt ggattgccta ctcccccagg aatgggtgct gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctgctga gatttgtgaa tccagacaca ggtagggtcc
     6541 tgtttgagtg caaacttcat aaatcaggct atgtcacagt ggctcacact ggcccgcatg
     6601 atttggtcat cccccccaat ggctacttca gatttgattc ctgggttaac caattctaca
     6661 cgcttgcccc catgggaaat ggagcggggc gtagacgtgc gttataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 ctttcaattt agcagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acagggtatg atggaagtta aacaggcaat
     6961 gctcttagag ggtggattct ctgaaacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggattgga gcggaacaag gtactgggct cctgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccacccctca accttcgggg gcactgccag gaagaattaa
     7141 tcccagggct cctgcccccg ctcagggctc ctccagcaca ccctctagta cttctactgc
     7201 tacttctgtg tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccagtgtc tcgagtctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 caggaatttg tcacctttca tgaggggggc tcacaacata tcgttcgtca ccccaccatc
     7381 tagtagatct tctagccaag gcacagtctc aaccgtgcct aaagaaattt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtctttt
//