Typing tool

Complete norovirus genomes

EF187497  GII.4 Yerseke
 GII.P4 Hunter

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       EF187497                7559 bp    RNA     linear   VRL 06-FEB-2012
DEFINITION  Norovirus Hu/GII.4/Kenepuru/NZ327/2006/NZL, complete genome.
ACCESSION   EF187497
VERSION     EF187497.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Kenepuru/NZ327/2006/NZL
  ORGANISM  Norovirus Hu/GII.4/Kenepuru/NZ327/2006/NZL
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Tu,E.T., Bull,R.A., Greening,G.E., Hewitt,J., Lyon,M.J.,
            Marshall,J.A., McIver,C.J., Rawlinson,W.D. and White,P.A.
  TITLE     Epidemics of gastroenteritis during 2006 were associated with the
            spread of norovirus GII.4 variants 2006a and 2006b
  JOURNAL   Clin. Infect. Dis. 46 (3), 413-420 (2008)
   PUBMED   18177226
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Tu,E.T.-V., McIver,C.J., Bull,R.A., Lyon,M.J., Greening,G.E.,
            Hewitt,J., Marshall,J.A., Rawlinson,W.D. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-DEC-2006) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   3  (bases 1 to 7559)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Feb 6, 2012 this sequence version replaced EF187497.1.
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/GII.4/Kenepuru/NZ327/2006/NZL"
                     /mol_type="genomic RNA"
                     /strain="Hu/NZ327/2006/NZL"
                     /isolation_source="fecal specimen"
                     /db_xref="taxon:438974"
                     /country="New Zealand"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ABQ81515.2"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELAPLSLYWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYVLQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIASSLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLSLAPQGGFDKNGNTPHGRGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLATFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGCTYVLESDGKGNVKVDRVQSASVQTNNELTGALHHLR
                     CARIRYYVKCIQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEENTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKNMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTASLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ABQ63283.2"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIVFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSTIVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGTQEYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRRDGSTRGHKATVSTGSVNFTPKLGRIQFSTDTSNDFETGQSTRFTPVGVVQDG
                     STTHQNEPQQWVLPDYSGRDSHNVHLAPAVAPSFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AEZ56467.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARSTTYNAGRFSTPQPSGALPGRTNLRAAVPARGSSNTPS
                     NSSIATSVYSNQTASTRLGSTAGSGASVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7514..7559
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagtatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcccaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtta aaaatattcc ccctcccccg cccaacggag aggatgaaat
      241 agtggtttct tatagtgtca aagatggtgt ttccggtttg cctgaccttt ctaccgtcag
      301 gcaaccagaa gaatctaaca cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gagccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgtggagc gaggtcttgt actgggtgtg cataaaccac cagctgccat
      481 tagcctcgct agggtcgagc tagcaccact ctccttgtac tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acactctcaa gaaattacac ggagaaacgt tcccctacac
      601 agcctttgac aacaattgct atgccttttg ttgctgggtc ctggatctaa atgactcgtg
      661 gctgagcagg agaatgatcc agaggacaac tggtttcttc aggccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgactc caaattaaag aaggtggcta acatattcct
      781 gtgtgctctg tcttcgctat tcaccaggcc cataaaggat ataataggga agctaaggcc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggact tttgcaggca tagtggagtc
      901 cctgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactaggtg actacgtgct gcaaggacct gaggatcttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtactagga ttcaccaaag agaagatagg
     1081 aaaaatgctg tcatctgctg catccacctt gagagcttgt aaagaccttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaggagg aagcaaatga
     1201 actggctata gtgagatcta tcgaggatgc agtcctggat ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcta ggaaactctc aaccaagtct gcttcacctg acattgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tctctggtgc atcgagcgaa
     1441 ggaggaactt tccagcagac caagacctgt agtattgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcatcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaacgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgatg ctctcaggtt
     1681 gcaagaactc gctgacactt gccccctcac tctaaactgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga agcgtgactt cccaggtcaa cctgacatgt ggaagaacgc
     1921 cttcagttct gatttctcac acataaaact atcattggcc ccacaaggtg gcttcgacaa
     1981 gaacgggaac accccacacg gaaggggcgt catgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gttagatgaa tttgagctac agggcccaac
     2101 tctcgccacc ttcaatttcg atcgcaataa agtgcttgcc ttcagacaac ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgaa agttgggaga cagctcaagg atgtcagaac
     2221 catgccagaa ctcaaacaag ctctcaagaa tatctcaatc aagaagtgcc agatagtgta
     2281 tagtggttgc acctacgtac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcgcc tccgtgcaga ccaacaatga gctgactggt gccctgcatc atttaaggtg
     2401 cgccagaatc agatactatg ttaagtgtat ccaggaggcc ctgtattcca tcatccaaat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa acacagagga gaacaccagc aaggacgggt gcccaaaacc
     2581 caaagatgat gaggagtttg tcatttcatc cgacgacatc aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgcg gcaaaaagca cacagccttt tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta cgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttt tgtgaagagg aggaggccaa gatccggcaa agaatcttca gaccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtctagtt acaggttctg aaattaggaa
     2941 aagaaaccca gatgatttca aacccaaggg gaaactgtgg gctgacgatg acagaagcgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggat tctgggtctc ccctagcctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgag ttctgccgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcac ccgagggcac cgtggtcaca ctactcatca aaaggtctac
     3301 tggggaactc atgcccctag cagctaggat ggggacccat gcaaccatga aaatccaagg
     3361 gcgcactgtt ggaggccaaa tgggcatgct tctgacagga tccaacgcca aaaacatgga
     3421 tctgggtact acaccaggtg attgtggctg tccctacatc tacaagagag gaaacgatta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ctacacttga aggtggtgac aacaagggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaagacca aattctggag
     3661 gtcgtccaca gcatcactcc cgcctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccctagagtc aagggtggtc cttcactgca gcaagttatg agggaacagt tgaagccatt
     3781 cacagagccc aggggcaagc caccaaagcc aagtgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgagcaga caattgatcc acctgagaaa tggtcattcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttccagtgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacagct gcgcttaagg atgaattagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 gaccatgatc cggtgtgctc gggcattcgg aggcctaatg gacgaactca aagcacactg
     4201 tgtcacactc cccattagag ttggtatgaa catgaatgag gatggcccca tcatcttcga
     4261 gaggcattcc aggtatacat atcactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aatcatggtt aaattctccc cagaaccaca
     4381 tttggctcag gtagtcgcag aagaccttct ttctcctagc gtggtggacg tgggtgactt
     4441 cacaatatca atcaacgagg gtctcccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gttacaaact tgtcccctga
     4561 caccatacag gccaattccc tcttctcttt ctatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaga aattgacagc aaagcttagg gaatatgggt taaaaccaac
     4681 ccgccctgac aaaactgaag gaccccttgt tatctctgaa gacttgaatg gcctgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ctccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt gatgtcccta ctgggggagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctatcgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cctgatttga
     5341 atccctacct ttcccacttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaattct cgcggggaac gcgttcaccg ctggaaaaat tgtatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc catataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 atcattacaa tcaatcaaat gaccccacca tcaagttgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgctggg gaagatgtct tcacagtttc ttgtcgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttgg tgccacccac agttgagtca agaactaaac
     5761 cattctctgt cccaatttta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagtt gttcacgggt cccagcagta ccattgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ctaggtacta cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggca ctcaagaata cacaatgaat ctggcctccc
     6001 aaaactggaa caattacgac ccaacagaag aaatcccagc ccctctggga actccagatt
     6061 tcgtgggaaa gatccaaggc gtgctcaccc aaaccacaag gagggatggc tcgacccgcg
     6121 gtcacaaagc tacagtgagc actggaagtg tcaacttcac cccaaagctg ggcagaattc
     6181 aattctccac tgatacaagc aatgactttg aaactggcca aagcacgaga ttcaccccag
     6241 tcggtgttgt ccaggatggc agtaccaccc accaaaatga accccaacaa tgggtgctcc
     6301 cagattattc aggtagggac agtcataatg tacacctagc ccctgccgtg gccccttctt
     6361 ttccgggcga gcaacttctt ttcttcaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatgaattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagataca ggtagggttc
     6541 tgtttgagtg taagcttcat aagtcaggct atgttacagt ggctcacact ggccagcatg
     6601 atttggttat cccccccaat ggctatttta gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctaa tcaacgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataat agaaaattgc aacaagcttc
     6841 cttccaattt agcagcaacc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttaca gcaggaaatg atgaaagtta aacaggctat
     6961 gctcctagag ggtgggttct ctgagacaga tgcagcccgt ggggctatca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggct cccgatgcta ggagtacaac
     7081 atacaatgca ggccgctttt ccacccctca accctcgggg gcactgccag gaagaactaa
     7141 tcttagggct gctgtccccg ctcggggctc ctctaacaca ccttctaatt cttctattgc
     7201 tacttctgtg tactcaaatc aaactgcttc aacgagactt ggttctacag ctggttctgg
     7261 tgccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gaatattctt cttttcttta gtgtctttt
//