Typing tool

Complete norovirus genomes

DQ456824  GII.2
 GII.P2

Length: 7,536 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       DQ456824                7536 bp    RNA     linear   VRL 11-SEP-2012
DEFINITION  Norovirus Hu/MK04/2004/JP, complete genome.
ACCESSION   DQ456824
VERSION     DQ456824.1
KEYWORDS    .
SOURCE      Norovirus Hu/MK04/2004/JP
  ORGANISM  Norovirus Hu/MK04/2004/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Hansman,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-MAR-2006) Virology II, NIID, 4-7-1 Gakuen,
            Musashimurayama, Tokyo 208-0011, Japan
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Hansman,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-SEP-2012) Virology II, NIID, 4-7-1 Gakuen,
            Musashimurayama, Tokyo 208-0011, Japan
  REMARK    Amino acid sequence updated by submitter
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus Hu/MK04/2004/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/MK04/2004/JP"
                     /isolation_source="stool specimen"
                     /db_xref="taxon:379081"
                     /country="Japan: Tokyo"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ABE41640.1"
                     /translation="MKMASNDASAAAAVNSNNDNTKSSSDGMFNNVAVTLKRALGARS
                     KQPAPREKPPRPPRPPTPELIKRIPPPPPNDGDEPTVMFSTVGGVSGLPELTTVGQPP
                     EANTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     IAKVELTPLSLYWRPVYTPQYLISPDTLRKLHGELFPYTAFENNCYAFCCWVLDLNDS
                     WLSRRMISRTTGFFRPYQEWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILLAELFDVFWTPPDVSAMIAPLLGDYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKNSLAAYMKTLDMEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREL
                     AKKIASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLVNPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDAYRSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPPLSTFNFDRNKIAAFRQLAAENKYGLVDTMRVGNQLRNVTTM
                     DELKKAIKNIIIRKCQIVYGGNTYTLESDGKGKVVVERVQSASVQINNEIAGAVHHLR
                     CARIRYYVKCVQEAIYSLLQIAGTVFVTSRIISRMNIQNLWSRPLTEDADEATMKEGC
                     PKPREEEEFVVSSDDIKPEGKKGKNKSGRGKKHTAFSSKGLSDEEYEEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEVKIRQRIFRPTRKQRKEERANLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERISFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGITEAFGVPIRQVQIHKSGEFCRLRFPKPIRTDVSGMILEEGAPEG
                     TVATILIKRTTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSYAQACASLDKTTSSGYPHHVRKNEHW
                     NGESFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTEKVYGKIKKRLLWGSDL
                     ATMVRCARSFGGLMDELKAHCVTLPIRVGMNMNEDGPIVFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAAMEIMVKFSAEPQLAQIVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTGKLR
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQLYWTKGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHEPSFYSKISKLVISELKESGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSLVNEDGVE"
     CDS             5085..6713
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ABE41641.2"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     VISQRDKHNSPGHNEPANRGHDAVVPTYTSQYTPKLGQIQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYIPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6713..7492
                     /note="ORF3"
                     /codon_start=1
                     /product="unknown"
                     /protein_id="ABE41642.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQRLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGRFTPTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTNLSQSTVSRATSRTGEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc tgctgccgct gctgttaaca gcaacaacga
       61 caacacaaaa tcttcaagtg acggaatgtt taacaacgtg gccgtcaccc ttaaacgagc
      121 cctcggggcc cggtccaaac agccggcccc gagggaaaaa cccccaagac cccctagacc
      181 accaacacca gaactaatca aaagaattcc ccccccacca cccaatgatg gggacgaacc
      241 aaccgtgatg tttagcactg taggtggtgt gtctggccta cctgagctca caacagtcgg
      301 tcaaccacct gaagctaaca cggcctttag tgtgcctccc ctcagccaaa gggaaaacag
      361 ggacgctaag gaaccgctaa ctggaactat tctggaaatg tgggatgggg agatctatca
      421 ttatggactg tatgtggaaa gagggcttgt gttaggcgtg cacaagccgc cagctgccat
      481 cagcatagcc aaagtggaat taacgcccct ctcactgtat tggagacctg tgtacacgcc
      541 tcagtacctt atatcccctg acaccttgag gaaactccat ggtgaattgt ttccctatac
      601 agcctttgaa aacaactgtt atgccttctg ctgttgggtt ttggatctta acgattcatg
      661 gctaagcagg aggatgatta gtaggaccac cggctttttc aggccctacc aagagtggaa
      721 caggaagccc cttccaacta tggatgactc aaaattgaag aaggtcgcaa acatcgttct
      781 gtgtgcattg tcatcattgt tcactagacc catcaaggat ataattggca aacttaaacc
      841 cctcaacatc ctaaacattc tggcctcatg cgattggact ttcgctggca tagtagagtc
      901 actaatcctc ttggctgaac tctttgatgt gttctggaca cccccagatg tgtctgcaat
      961 gatcgcaccc ctcctcggtg actacgagct acaaggcccc gaagacatcg ctgtggagct
     1021 cgtgcccgtt gtgatgggtg ggataggtct ggtgttggga ttcaccaaag agaaaatagg
     1081 taagatgctc tcctctgcag cgtcaaccct gagggcatgc aaagatcttg gagcctatgg
     1141 attggagatc ttgaaactag tcatgaaatg gtttttccca aagaaggatg aggccaacga
     1201 actggctatg gttagagcca ttgaagacgc tgtattagac ctggaggcca ttgagaacaa
     1261 ccatatgacc actctattga aagacaagaa cagccttgca gcctacatga agaccttgga
     1321 catggaagag gaaaaagcta ggaagttatc caccaaatca gcctcccctg acattgtggg
     1381 caccataaac gccctgctgg ctaggatcgc cgccgcgcgt tccttagttc atagggccaa
     1441 ggaggagctc tctagcagac caagaccggt cgttctgatg atctctggca aaccagggat
     1501 aggaaagacc cacttggcca gagaactggc aaagaaaatt gcctcgacgc tcacaggaga
     1561 tcagagggtg ggcctcatcc cacggaatgg agttgaccac tgggacgcct acaaaggtga
     1621 gagagtggtg ctctgggatg actacgggat gagcaacccc atccacgatg cgctgaggtt
     1681 gcaggaactg gcagacacat gtccattaac tttaaattgt gacaggattg aaaacaaggg
     1741 gaaagtcttc gatagcgacg cgatcataat taccaccaat ttggtcaatc ccgcgccgct
     1801 ggattacgtc aactttgagg cctgctccag acgtatagac ttccttgtgt atgctgatgc
     1861 cccagaagtc gagaaggcaa agcgggactt ccctggtcaa ccggacatgt ggaaggacgc
     1921 ctatcgctct gacttctcac acattaaact acaacttgca ccacagggtg ggtttgacaa
     1981 aaatggaaac accccacatg gtaaaggagt gatgaagact ctcactgcca gttcactggt
     2041 tgcacgtgcc tctggtctct tgcacgagag attagatgag tacgagctac agggtccgcc
     2101 cctctcaacc ttcaactttg accgcaacaa aattgcagcg ttcaggcaac tcgccgctga
     2161 aaataagtat ggtctggtgg acacgatgag ggtgggcaac cagctcagaa atgttacgac
     2221 catggatgaa ctcaagaagg ctatcaagaa catcataatc agaaagtgcc agatagtcta
     2281 cggtggtaac acttacacgc ttgagtctga cggcaagggt aaggttgtgg ttgagagggt
     2341 gcagagcgcc agcgtgcaaa tcaacaatga gatcgctggt gcagtacacc accttagatg
     2401 tgccaggata aggtattatg tcaagtgtgt ccaagaggcc atctactcac tcctccaaat
     2461 cgccggcacg gtgtttgtca cttcacgcat cataagccgc atgaacatcc aaaatttatg
     2521 gtccaggcca ctaaccgaag atgcagatga ggccactatg aaagaggggt gccccaaacc
     2581 tagggaagaa gaggaatttg tcgtctcctc agatgacatc aagccagagg gcaagaaagg
     2641 taaaaacaag agtggccggg gcaagaaaca cacggcattc tcaagcaaag gtctcagtga
     2701 tgaggagtac gaagagtaca aaaggatcag agaggagaga aatggcaagt actccataga
     2761 ggaataccta caggacagag acaaatacta tgaagaggtg gccattgcca gggcaactga
     2821 agaagacttc tgtgaagagg aagaggttaa gattcgtcag aggatcttca ggccaacaag
     2881 aaaacaacgc aaggaagaaa gagccaacct tggcctcgtt accgggtctg agatcagaaa
     2941 gaggaaccca gatgacttca aaccaaaagg aaaactgtgg gccgacgatg ataggagcgt
     3001 cgactacaat gaaagaatca gctttgaggc cccaccaagt atatggtcta gaattgtcaa
     3061 ctttggttct ggatgggggt tttgggtgtc acctagcctc ttcataacat caacacatgt
     3121 catacctcaa ggcataactg aggcctttgg tgtacctata aggcaggtgc aaatacacaa
     3181 atcaggcgaa ttctgtcgcc tgagattccc aaaacccatc aggacagatg tgtcaggtat
     3241 gatactggag gagggagcgc ctgaaggcac tgttgccacc atactcatca aaagaaccac
     3301 tggagagctg atgcctctcg cagcaagaat gggcacccac gcgaccatga ggatacaagg
     3361 acgcacggtg ggcggccaga tgggaatgct gctcactggg tccaatgcaa agagcatgga
     3421 tcttggcacc acgcccggtg attgtgggtg tccctacatt tacaaaaggg gcaacgacta
     3481 catagtcatt ggagttcaca cagcagccgc tcgtggcgga aacactgtca tctgcgccac
     3541 acagggtagt gagggtgagg ccacgctcga gggtggtgac aacaaaggaa catactgtgg
     3601 ggcgccaatc ctaggccccg ggaatgcccc aaaactgagc accaaaacca aattctggag
     3661 gtcctccaca acaccacttc cacccggcac atacgagccg gcgtatctgg gaggaaaaga
     3721 cccccgagtc aaaggtgggc catctctgca acaagttatg cgagaccaac tgaagccatt
     3781 caccgaaccc cgtggtaagc caccaaaacc aagtgtcctc gaagctgcta aaaagacaat
     3841 tatcaatgtg ctagagcaaa caatagaccc cccacaaaag tggtcgtacg cacaagcgtg
     3901 cgcgtctctt gacaaaacta catctagtgg gtacccccac cacgtgcgca aaaacgagca
     3961 ctggaatggg gaatctttca caggaaaatt ggctgaccag gcatcaaaag caaacctaat
     4021 gtttgaagag gggaagcaca tgaccccagt ttacacagct gcccttaagg atgaattggt
     4081 caaaactgag aaagtgtatg ggaagataaa gaagaggttg ctttggggct ctgacctggc
     4141 taccatggtg cggtgcgcgc gctcctttgg cggtttgatg gacgaactca aggcccactg
     4201 tgtgacactt ccgataaggg ttggcatgaa tatgaatgaa gatggaccaa tagtctttga
     4261 gaagcactcc agatacaggt atcactatga tgcagattat tccaggtggg attcaacaca
     4321 gcagagagcc gttctggccg cggccatgga gattatggtt aaattctcag cagagccaca
     4381 actagcccaa atagttgcag aggatctatt gtcgcctagc gtagttgacg tgggcgactt
     4441 caaaatttcc atcaacgaag gattgccgtc gggtgtccct tgcacctctc aatggaattc
     4501 catcgcacac tggctcctca ccttatgtgc cctttctgaa gttacagacc tctctcctga
     4561 cattgtgcag gccaactccc tcttctcctt ttatggtgat gatgaaattg tgagcacaga
     4621 tatcaaatta gacccagaaa agttgacggg gaagttgaga gaatatggcc tcaaacccac
     4681 tcgtccagac aaaactgaag gccccctgat cattagtgag gatctgaatg gcctgacttt
     4741 cctgaggaga accgtcactc gcgaccctgc aggatggttt ggcaaactgg accaaagttc
     4801 catacttagg caactgtatt ggaccaaagg ccccaatcat gaagatccct ttgagtcaat
     4861 gattccacac tcccagagac ccatacaact catgtcactc ttgggcgaag cagcactgca
     4921 tgaaccatca ttctacagca agatcagcaa gcttgtgata tctgagttga aagaaagtgg
     4981 aatggatttt tacgtgccca ggcaagaacc tatgttcagg tggatgagat tctcagattt
     5041 gagcacgtgg gagggcgatc gcaatcttgc tcccagtctt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aataatgagg
     5161 tcatggctct tgaacccgtg gctggcgccg ccttggcagc cccggtcacc ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccctaatggt gaatttacag
     5281 tctctccccg taatgcccct ggtgaagtgc tattgaatct agagttgggt ccagaattaa
     5341 atccttatct ggcacattta gcaagaatgt acaacgggta tgccggtggg atggaggtgc
     5401 aggtcatgtt ggctgggaac gcgttcacag ccggcaagtt ggtcttcgcc gctgtgccac
     5461 ctcacttccc ggttgaaaac cttagtccac agcaaattac catgttccct catgtgatta
     5521 tagatgtaag gactttggaa cctgttttat taccactccc tgatgttaga aataatttct
     5581 tccattataa tcagaaagat gatcccaaga tgagaattgt ggctatgctt tatacccccc
     5641 ttaggtctaa tggttcaggt gatgatgtgt ttacagtctc ctgcagggtg ttgactagac
     5701 cctcccctga ttttgatttc acatatctgg tgccaccaac agtggagtct aaaacaaaac
     5761 catttaccct cccaatcctc acacttgggg aactttccaa ttctagattc ccagtgtcca
     5821 tagaccagat gtacaccagc cccaatgaag ttatatcagt gcagtgtcaa aatggtaggt
     5881 gcacactgga tggggagctc caaggaacaa cacaactcca agtcagtggt atttgtgctt
     5941 tcaagggaga agtgaccgcc catttgcatg acaatgatca tctatataat gtcaccatca
     6001 caaacttgaa tgggtccccc tttgacccct ccgaggacat ccctgcccct ctgggcgtac
     6061 ctgactttca gggaagggtc tttggtgtca tctcccaaag agacaaacac aattcccctg
     6121 gacataatga accagcaaat agggggcacg acgctgtggt ccctacttac acatcacagt
     6181 acactccaaa attgggtcag attcaaattg gcacatggca aaccgatgat cttacagtca
     6241 accaaccagt caaattcacc ccagttggac tcaatgacac tgaacatttt aaccaatggg
     6301 tggtccccag atatgctggt gctctaaacc ttaacacaaa ccttgcccct tctgttgctc
     6361 cagtatttcc aggggagcgc ctgctctttt tcagatcata catccccctc aagggtggtt
     6421 atggaaatcc agccattgat tgcctactac cacaagagtg ggtgcagcat ttctatcagg
     6481 aagcagcccc ttcaatgagt gaggtggccc ttgtcagata catcaacccg gatactggtc
     6541 gggcactgtt tgaggccaag ctccacagag ctggtttcat gacagtctca agcaacacca
     6601 gtgccccggt ggttgtgcct gccaacggat acttcagatt tgattcttgg gtgaaccaat
     6661 tctattctct cgcccccatg ggaactggaa atgggcgtag aagggttcaa taatggctgg
     6721 agcttttgta gctggtcttg caggggacgt gctcagcaat gggctcagtt cattaattaa
     6781 tgcaggtgct aatgcaataa atcagagggc agaatttgat tttaatcaga gattacagca
     6841 aaattctttt aatcatgata aggaaatgtt gcaggctcag attcaggcaa ctaagcagct
     6901 gcaggcagac atgatggcta taaagcaggg ggtcctgacc gctggcggct tttcccctgc
     6961 tgacgcagcc agaggtgctg tgaatgcgcc catgacacag gcgctggatt ggaacggcac
     7021 aaggtattgg gcaccaggct ccatgaggac cacatcttac tctggaagat tcacaccaac
     7081 cgccccagtg aggcaggccg acttccagca cacccaaagc cggccctcga gtggctcttc
     7141 tgtgtcctcc tttgctactc agtcttcaag gccaactctg actacaacca ctgggtcctc
     7201 acatggcaca gcctcatcaa actcgactcg cagcacaaac ctctcccaat caacggtctc
     7261 tagggccaca tctaggactg gtgagtgggt tagagatcaa aatagaaatt tggaacccta
     7321 tatgcatggt gccttacaga cagcctttgt caccccacct tccagcaggg cgtctgacgg
     7381 aacggtctca accgtcccaa aaggtgtttt ggactcctgg acacctgcgt tcaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagctt agtgaaaagg
     7501 tgaaaattta tctaaaatga attgatctta cctttt
//