Typing tool

Complete norovirus genomes

DQ369797  GII.4 Asia
 GII.P12

Length: 7,558 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       DQ369797                7558 bp    RNA     linear   VRL 08-FEB-2006
DEFINITION  Norovirus Hu/Guangzhou/NVgz01/CHN, complete genome.
ACCESSION   DQ369797
VERSION     DQ369797.1
KEYWORDS    .
SOURCE      Norovirus Hu/Guangzhou/NVgz01/CHN
  ORGANISM  Norovirus Hu/Guangzhou/NVgz01/CHN
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7558)
  AUTHORS   Zeng,Q.Y., Zhou,R., Zhong,J.Y., Zhu,B., Li,X., Chen,Y., Lin,T. and
            Gong,S.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JAN-2006) Central Laboratory, Guangzhou Children's
            Hospital, Guangzhou Ren Min Road No. 318, Guangzhou, GuangDong
            510120, China
FEATURES             Location/Qualifiers
     source          1..7558
                     /organism="Norovirus Hu/Guangzhou/NVgz01/CHN"
                     /mol_type="genomic RNA"
                     /strain="Hu/Guangzhou/NVgz01/CHN"
                     /db_xref="taxon:370037"
                     /country="China: Guangzhou"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /note="N-terminal helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ABC96331.1"
                     /translation="MKMASNDASAVAAANSNNDTAKSSSDGVLSSMAVTFKRALGARH
                     KQPPPREIPQRPPRPPTPELAKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTTLEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLITRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLTPRNGVGHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     PGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     PELKQALKNVAIKNCQIVYGGCTYRLESDGKGDVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDPWSKPQVEDTEETASNDGC
                     PKPKDDDEFVVSSDDIKTEGKKGKNKSGCGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKGPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGRPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCAPSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELREGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGAE"
     gene            5085..6707
                     /gene="ORF2"
     CDS             5085..6707
                     /gene="ORF2"
                     /codon_start=1
                     /product="capsid VP1"
                     /protein_id="ABC96332.1"
                     /translation="MKMAPNDASPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVSICTFRGDVTHIPGTRIYRMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTKGDGSTRGHKATVSTGSVDFTPKLGSVQFATDTDNDFETGQNTRFTPVGVIQDG
                     SSAHRNEPQQWVLPDYSGRTVHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPSQSDVALLRFVNPDTGRVLFECKLHKAGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     gene            6707..7513
                     /gene="ORF3"
     CDS             6707..7513
                     /gene="ORF3"
                     /codon_start=1
                     /product="hypothetical protein VP2"
                     /protein_id="ABC96333.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFEFSSNLQQASFQHDKEMLQAQIEVTKKLQQGMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRTNPRATVPARGSPSMPP
                     NTSTVTSVYSDQTVSTRLGSTAGSGTRVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgtcgct gctgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcataaac agcctccccc gagggaaata ccacaaagac ctccacgacc
      181 acccaccccg gaacttgcca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtttct tacagcgcca aagatggcgt ttccggtttg cctgagctta ccactgtctg
      301 gcagccggat gaaaccaaca cggcgttcag tgttccccca ctcaaccaga gggagaatag
      361 ggacgccaag gagccgctaa ccggaacaac cctggaaatg tgggacgggg agatctatca
      421 ttacggtctg tatgtggagc gaggccttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggttgagc tagcaccact ctctctgttt tggagaccag tgtatacacc
      541 acagtatctc atctctccag acactctcag gagactgcat ggagagtcgt tcccctacac
      601 agcctttgac aacaactgct atgccttctg ttgttgggtc ctggacctaa acgactcgtg
      661 gttgtgcagg agaatgatcc agaggacaac tggtttcttc agaccttacc aagactggaa
      721 caggaaaccc ctccccacca tggatgactc caaattgaag aaggtagcca acatattctt
      781 gtgtgcgcta tcttcgctta tcactaggcc catcaaagac ataataggaa aggtgaggcc
      841 gcttaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 tttgatcctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactaggtg actacgaact gcaggggccc gaggaccttg cagtggaact
     1021 cgttccagta gtgatggggg ggattggttt ggtgctagga ttcactaaag agaagatcgg
     1081 aaaaatgttg tcatctgctg catccacctt aagggcttgt aaagaccttg gtgcatacgg
     1141 actggaaatc ctaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gttggctatg gtgaggtcca tcgaggatgc ggtgctggac ctcgaagcaa ttgagaacaa
     1261 tcacatgact gccctcctca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 cctcgaggag gagaaggcca ggaagctttc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gctctcctgg cgagaatcgc cgctgcacgc tccctggtgc atcgggcgaa
     1441 agaggaactc tccagcagac caagacctgt tgttgttatg atatcaggta ggccagggat
     1501 agggaaaact caccttgcta gggaactggc caagaaaatc gcagcttcgc ttacaggaga
     1561 ccagcgtgtg ggtctcaccc ctcgcaatgg cgttggtcac tgggatgcat ataaggggga
     1621 aagagtcgtc ctatgggacg attatggaat gagtaatccc atccacgacg ccctcagatt
     1681 acaggaactt gctgacacct gccccctcac actaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaat ctggccaacc cagcaccatt
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt acgcagaagc
     1861 ccctgaggtc gagaaggcaa agcgtgattt cccaggtcaa cctgacatgt ggaagaacgc
     1921 attcagttct gacttctcgc acataaaact gacgctggct ccgcaaggtg gcttcgacaa
     1981 gaacggaaac accccacacg ggaaaggcgt catgaaaacc ctcaccactg gttccctcat
     2041 cgcccgagca ccagggttac tccatgagag gttagatgag tatgagctgc agggcccaac
     2101 ccctaccacc tttaactttg accgcaacaa ggtgcttgcg ttcagacagc ttgctgccga
     2161 aaacaagtac gggttgttgg acacaatgag agttggaaaa cagctcaagg atgtcaagac
     2221 catgccagag ctcaaacaag cgctcaaaaa tgttgcaatc aaaaattgtc agatagtgta
     2281 tggtggctgc acttacaggc ttgagtctga tggcaagggt gatgtaaaag ttgacagagt
     2341 ccagaacgcc actgtacaga ccaacaatga gcttgccggc gccctacatc atcttaggtg
     2401 tgccagaatc agatattatg tcaagtgtgt ccaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagca gcatttgtaa ccacgcgcat tgtcaagcgc atgaacatac aagacccctg
     2521 gtccaagcca caggtggagg acacagagga gaccgccagc aatgacgggt gcccaaaacc
     2581 caaggatgat gacgagttcg ttgtctcatc cgatgacatc aaaaccgagg gcaagaaagg
     2641 gaagaacaag tctggctgtg gcaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca aaagaatcag agaagaaagg aacggcaaat actccataga
     2761 ggaatacctt caggacagag acaagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaagaag aagaggccaa gatccgacaa aggattttca ggccaacaag
     2881 gaaacaacgc aaagaggaga gggcctctct cggtttggtc acaggctctg aaatcaggaa
     2941 gaggaaccca gacgacttca agcctaaagg aaagctgtgg gctgatgatg acaggagtgt
     3001 tgactacaat gagagactca attttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ttttggttcg ggttggggct tttgggtctc ccccagcctg ttcataacat caactcatgt
     3121 cataccccag ggtgcacagg agttctttgg tgttcccatc aaacaaattc agatacacaa
     3181 atcgggtgaa ttctgtcgtt tgaggtttcc aaaaccaatc agaactgacg taacaggcat
     3241 gatcttagaa gaaggtgcac ccgaagggac cgtggtcaca ctactcatta aagggccaac
     3301 tggagaactc atgcccttgg cagccagaat gggaacccat gcaaccatga agattcaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct cctaacagga tccaacgcca agagtatgga
     3421 cctgggcacc acaccaggtg actgtggccg tccctacatt tacaagaggg ggaatgacta
     3481 tgtggtcatt ggagtccaca cagctgccgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaagggagc gagggagaag ccacacttga aggcggtgac agcaagggga cctactgcgg
     3601 tgcaccaatc ttaggtccag ggagtgcccc aaagctcagc accaagacta aattctggag
     3661 atcatccacg gcaccactcc cacctggtac ctatgagcca gcctacctcg gcggcaagga
     3721 ccctagagtt aagggtggcc cttcattgca acaagttatg agggaccagc tgaaaccatt
     3781 cactgaaccc aggggtaaac caccaaagcc aagtgtgttg gaagctgcca agaaaaccat
     3841 cgtcaatgtc cttgaacaaa caattgatcc acctcaaaaa tggtcatttg cgcaggcatg
     3901 cgcatccctt gacaagacca cttccagtgg tcacccgcac cacatgcgga aaaacgactg
     3961 ctggaacgga gaatccttta caggcaaatt ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaggag ggaaagaaca tgaccccagt ctacacgggt gcgcttaagg acgagctggt
     4081 caagactgac aaaatttatg gcaagatcaa aaagaggctt ctctggggtt cggacctggc
     4141 gaccatgatc cggtgcgctc gagcattcgg gggcctgatg gaggaactca aagcacattg
     4201 tgtcacacta cctgtcagag tgggtatgaa tatgaatgag gatggtccta tcatctttga
     4261 gagacactcc agatataaat atcattatga tgctgattac tcccggtggg actcaacaca
     4321 acaaagagcc gtgttagcag cggctttaga aatcatggtc aagttctccc cagagccgca
     4381 tctggcccaa aaagttgcag aagaccttct ttctcccagc gtgatggacg tgggtgattt
     4441 caaaatatca atcaatgagg gcctcccctc cggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctatgtgc accctctgag gttacaaacc tgtcccctga
     4561 cattatccag gccaactctc tcttttcttt ctacggtgat gatgaaattg tgagcacaga
     4621 cataaaattg gacccagaaa agttgacagc aaaactcaag gaatacgggt tgaaaccgac
     4681 ccgccctgac aagactgagg gaccccttgt tatctctgaa gacctgaatg gcctaacctt
     4741 cctgcggagg accgtgaccc gcgacccagc aggctggttt ggaaagttgg aacagagttc
     4801 aatactcaga caaatgtatt ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccagaggc ccatacaatt gatgtctttg ctgggtgagg ctgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa actggtcatt gcagagttga gggaaggtgg
     4981 catggatttt tacgtgccaa gacaagagcc aatgttcaga tggatgagat tctcggatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgccga
     5101 atgacgccag cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt aggaataatt ttgtgcaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatctga
     5341 atccatacct ttctcacctg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc tgatgttagg aataatttct
     5581 accattacaa tcaatcaaat gattccacca ttaaattgat agcaatgctg tacacaccac
     5641 ttagggccaa taatgctggg gatgatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccccga ttttgatttc atatttctgg tgccacccac agttgagtca agaaccaaac
     5761 cattcaccgt cccaatttta actgttgagg aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaaatt gttcacgggt cccagcagtg cctttgtcgt ccaaccacaa aatggcaggt
     5881 gcacgactga tggcgtgctc ttaggcacta cccaactgtc ccccgtcagc atctgcacct
     5941 tcagaggcga tgtcacccac attccaggta ctcgtattta cagaatgaat ttggcttctc
     6001 aaaattggaa caattatgac ccaacagaag aaattccagc ccctctggga actccagatt
     6061 tcgtgggaaa gatccaaggc atgctcaccc aaaccacaaa gggagacggc tcgacccgcg
     6121 gtcacaaagc tacagtgagc actgggagtg ttgacttcac tccaaagctg ggcagcgttc
     6181 agttcgccac tgatacagac aatgattttg aaactggcca aaacacaagg ttcaccccag
     6241 tcggtgtcat ccaggatggt agtagtgccc acagaaatga accccaacaa tgggtactcc
     6301 cagattactc aggtagaact gttcataatg tacacctagc ccctgccgta gcccccactt
     6361 ttccgggtga gcaacttctt ttcttcagat ctactatgcc cggatgcagt gggtatccca
     6421 atatggattt ggattgtcta ctcccccagg aatgggtaca gcacttctac caagaggcag
     6481 ccccatcaca atctgacgtg gctttgctga gatttgtgaa tccagacaca ggcagggttc
     6541 tgtttgagtg caagcttcat aaagcaggct atgtcacagt ggcgcacact ggccagcatg
     6601 atttggttat cccccccaat ggctatttta gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggagcggggc gtagacgtgc attataatgg ctggggcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctga tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttcgaattt agcagcaatc tacaacaagc ttcctttcaa catgacaaag agatgctcca
     6901 agcacaaatt gaggtcacta aaaagttaca gcagggtatg atgagagtca aacaggcaat
     6961 gctcctagag ggtggattct ctgaaacaga tgcggcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggct cctgatgcta gaaccacaac
     7081 atacaatgca ggccgttttt ccacccctca accttcgggg gcactgccag gaagaactaa
     7141 tcccagggct actgtccccg ctcggggctc ccccagcatg cctcctaaca cttctactgt
     7201 tacttctgtc tattcagatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccagagtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 caggaatttg tcacctttca tgaggggggc tcacaacata tcgttcgtca ccccaccatc
     7381 tagtagatcc tctagccaag gcacggtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggcg taatgtgaaa agacaaaatt gattatcttt cctttcttta gggtcttt
//