Typing tool

Complete norovirus genomes

DQ078814  GII.4 Hunter
 GII.P4 Hunter

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       DQ078814                7559 bp    RNA     linear   VRL 26-JUL-2016
DEFINITION  Norovirus Hu/GII.4/Hunter504D/04O/AU, complete genome.
ACCESSION   DQ078814
VERSION     DQ078814.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Hunter504D/04O/AU
  ORGANISM  Norovirus Hu/GII.4/Hunter504D/04O/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Bull,R.A., Tu,E.T., McIver,C.J., Rawlinson,W.D. and White,P.A.
  TITLE     Emergence of a New Norovirus Genotype II.4 Variant Associated with
            Global Outbreaks of Gastroenteritis
  JOURNAL   J. Clin. Microbiol. 44 (2), 327-333 (2006)
   PUBMED   16455879
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Bull,R.A., Tu,E.T.V., McIver,C.J., Rawlinson,W.D. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-2005) Biotechnology and Biomolecular Sciences,
            University of New South Wales, Anzac Parade, Sydney, NSW 2052,
            Australia
REFERENCE   3  (bases 1 to 7559)
  AUTHORS   Bull,R.A., Tu,E.T.V., McIver,C.J., Rawlinson,W.D. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-AUG-2009) Biotechnology and Biomolecular Sciences,
            University of New South Wales, Anzac Parade, Sydney, NSW 2052,
            Australia
  REMARK    Sequence update by submitter
COMMENT     On Aug 31, 2009 this sequence version replaced DQ078814.1.
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/GII.4/Hunter504D/04O/AU"
                     /mol_type="genomic RNA"
                     /strain="Hunter504D/04O"
                     /isolate="Hu/GII.4/Hunter504D/04O/AU"
                     /db_xref="taxon:332857"
                     /country="Australia"
     misc_feature    1..4
                     /note="5'NTR"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ACV32668.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKNIPPPPPNGEDEIAVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLFWRPVYTPQYLISPDALKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDLIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVHNGCTYTLESDGKGNVRVDRVQSASVQTNNELTGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEDDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTASLPPGTYEPAYLGGKDPRVKGCLSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AAZ31396.2"
                     /translation="MKMASNDATPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEVLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNLYHYNQSNDPTIRLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGTQNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGRIQGVL
                     TQTTRRDGSTRGHKATVSTGSVHFTPKLGSVQFSTDTSNDFETGQNTRFTPVGVVQDG
                     STTHQNEPQQWVLPDYSGRDSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQESAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     CDS             6707..7513
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ACV32669.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAVN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGASPGRTNLRATVPARGSSSTPS
                     NASAATSVYSNQTASTRLGSTAGSGTSVSSLPSTARARSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
     misc_feature    7514..7559
                     /note="3'NTR"
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaagc agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaatatccc ccctcccccg cccaacggag aggatgaaat
      241 agcggtttct tatagtgtca aagatggtgt ttccggtttg cctgatcttt ccaccgtcag
      301 gcaaccggaa gaatctaaca cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gagccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgtggagc gaggtcttgt actaggtgtg cacaaaccac cagctgccat
      481 tagcctcgct agggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acgctctcaa gaaattacac ggagagacgt tcccctacac
      601 agcctttgac aacaactgct atgccttttg ctgctgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc aggccctacc aagattggaa
      721 taggaaaccc ctccccacca tggatgactc caagttaaag aaggtagcta acatattcct
      781 gtgtgctctg tcttcgctat tcaccaggcc tataaaagat ttaataggga agctaaggcc
      841 tcttaacatc ctcaacatct tggcctcatg tgactggact tttgcaggca tagtggagtc
      901 cttgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg attacgagct acaaggacct gaggaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctata gtgagatcca tcgaggatgc agtcctggat ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc actttgctca aagacaaaga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tctctggtgc atcgagcgaa
     1441 ggaggaactt tccagcagac caagacctgt agtgttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaacccc atccacgatg ccctcaggtt
     1681 gcaagaactc gctgacactt gccccctcac cctaaactgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggctaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gaaaaggcga agcgtgactt cccaggccaa cccgacatgt ggaagaacgc
     1921 cttcagttct gatttctcac acataaaact aacattggct ccacagggtg gcttcgacaa
     1981 gaacgggaac accccacacg gaaagggcgt tatgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgaa ttcgaactac agggcccaac
     2101 tctcaccacc ttcaactttg atcgcaataa agtgcttgcc tttagacaac ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgaa agttggtagg cagctcaagg atgtcagaac
     2221 aatgccagag cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agatagtgca
     2281 taatggttgc acctacacac ttgagtctga tggcaagggc aatgtgagag ttgacagagt
     2341 tcaaagcgcc tccgtgcaga ccaacaatga gctgactggc gccctgcacc atctaaggtg
     2401 cgccagaata agatactatg tcaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa acacagagga gactaccagc aaggacgggt gtccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc cgacgacatc aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgcg gcaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagaggac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaggacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtttagtt acaggttctg aaattaggaa
     2941 aagaaatcca gatgatttca aacccaaggg gaaactgtgg gctgacgatg atagaagtgt
     3001 ggactacaat gagaaactca gttttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggat tctgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacataa
     3181 gtcaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcac ccgagggcac cgtggtcaca ctactcatca aaaggtccac
     3301 tggagaactc atgcccctag cagctaggat ggggacccat gcaaccatga aaatccaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 cctgggtacc acaccaggtg attgtggttg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ctacacttga aggtggtgac aataaaggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaagacca aattctggag
     3661 atcgtccaca gcatcactcc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccccagagtc aagggttgtc tctcactgca gcaagtcatg agggatcagt tgaagccatt
     3781 tacagagccc aggggcaagc caccaaagcc aagtgtgttg gaagctgcca agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcattcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttccagtgg ccatccgcat cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacagct gcgcttaagg atgaattagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 gaccatgatt cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcgcactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcattcc aggtacacat accactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aatcatggtt aaattctccc cagaaccaca
     4381 tttggctcag gtggtcgcag aagaccttct ttctcctagc gtggtggacg tgggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gttacaaact tgtctcctga
     4561 caccatacag gctaattccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaga agttgacagc aaagctcagg gaatatgggt taaagccaac
     4681 ccgccctgac aaaactgaag gaccccttgt catctctgaa gacttgaatg gcctgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaattgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ttccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt gatgtcccta ctgggggaag ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccac cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg cgattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatat tatggagcgc gcccttgggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaacttccc aactgaagtc ttgagcccca gccaggtcac tatgttcccc catataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccctgcc tgatgttagg aataatctct
     5581 atcattacaa tcaatcaaat gaccccacca tcagattgat agcaatgctg tatacaccac
     5641 ttagggctaa caatgctggg gacgatgtct tcacagtctc ttgtcgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttgg tgccacccac agttgagtca agaactaaac
     5761 cattctctgt cccaatctta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagtt gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggtacta cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggta ctcaaaatta cacaatgaat ctggcctccc
     6001 aaaattggaa caattatgac ccaacagaag aaatcccagc ccctctggga accccagatt
     6061 ttgtaggaag gatccaaggc gtgctcaccc aaaccacaag gagggatggc tcgacccgcg
     6121 gtcacaaagc cacagtgagc actggaagtg tccactttac cccaaagctg ggcagtgttc
     6181 aattctccac tgatacaagc aatgactttg aaactggcca aaacacgaga ttcaccccag
     6241 tcggtgtcgt ccaggatggt agtaccaccc accaaaatga accccaacaa tgggtgctcc
     6301 cagactattc aggtagagat agtcacaatg tacacctagc ccctgccgtg gcccccactt
     6361 ttccgggtga gcaacttctt ttctttaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatgaattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagagtcag
     6481 ccccagcaca atctgatgtg gcactgctga gatttgtgaa tccagacaca ggcagggttt
     6541 tgtttgagtg caagcttcat aaatcaggct atgtaacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggctatttca gatttgattc ctgggtcaac caattctaca
     6661 cacttgcccc catgggaaat ggagcggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggctctctaa tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgagtt tgaaaataac agaaaattgc aacaagcttc
     6841 cttccaattt agcagcaacc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgaaagtta aacaggcaat
     6961 gctcctagag ggtgggttct ctgagacaga tgcagcccgt ggggcagtca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccactcctca accctcgggg gcatcgccag gaagaactaa
     7141 tctcagggct actgtccccg ctcggggctc ctccagcaca ccttctaatg cttctgctgc
     7201 tacttctgtg tactcaaatc aaactgcttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aagggctagg agctgggttg aggatcaaaa
     7321 caggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagtagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtctttt
//