Typing tool

Complete norovirus genomes

AY823305  GII.18
 GII.P18

Length: 7,612 | 3 CDS

ORF1: 8..5083
ORF2: 5064..6737
ORF3: 6737..7564
LOCUS       AY823305                7612 bp    RNA     linear   VRL 27-JUN-2012
DEFINITION  Norovirus swine/GII/OH-QW125/03/US, complete genome.
ACCESSION   AY823305
VERSION     AY823305.2
KEYWORDS    .
SOURCE      Norovirus swine/GII/OH-QW125/03/US
  ORGANISM  Norovirus swine/GII/OH-QW125/03/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7612)
  AUTHORS   Wang,Q.H., Han,M.G., Cheetham,S., Souza,M., Funk,J.A. and Saif,L.J.
  TITLE     Porcine noroviruses related to human noroviruses
  JOURNAL   Emerging Infect. Dis. 11 (12), 1874-1881 (2005)
   PUBMED   16485473
REFERENCE   2  (bases 1 to 7612)
  AUTHORS   Wang,Q. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-NOV-2004) Veterinary Preventive Medicine, The Ohio
            State University, 1680 Madison Ave., Wooster, OH 44691, USA
REFERENCE   3  (bases 1 to 7612)
  AUTHORS   Oka,T., Wang,Q. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUN-2012) Veterinary Preventive Medicine, The Ohio
            State University, 1680 Madison Ave., Wooster, OH 44691, USA
  REMARK    Sequence update by submitter
COMMENT     On Jun 27, 2012 this sequence version replaced AY823305.1.
FEATURES             Location/Qualifiers
     source          1..7612
                     /organism="Norovirus swine/GII/OH-QW125/03/US"
                     /mol_type="genomic RNA"
                     /strain="OH-QW125/03/US"
                     /host="swine"
                     /db_xref="taxon:316620"
                     /country="USA"
                     /note="genogroup II"
     CDS             8..5083
                     /note="ORF1"
                     /codon_start=1
                     /product="RNA-dependent RNA polymerase"
                     /protein_id="AAX32879.2"
                     /translation="MMASNDVNVAAGDNTNGNEKQTKMPTSGIFTNVKVGIKKILGDR
                     DCDAQPPAPTPREKPEPPPPPEETVAGEPPPEGCVAYHKDGDRIDGLPRGPADAEPKC
                     MAYSAPPPHEREDGPAMEPLPGSILEMWDGEIYHYGLYVNDGLVLGVHRPASAICTAT
                     IELTPLSLYWRVVHVPQNVIPSETLKRLAGEKFPYTAFDNNCYAFCCWVLDLNDSWLS
                     RKMINRTTGFYKPYQVWNRKPLPTMDDGKMKKVTNVLLCALSSLFTRPIKDVIGSLKP
                     LNLLNLLASCDWTFGGIVETLVLVGELFGIFWTPPDVSAFLAPLLGDYELQGPQDLAT
                     ELVPILMGGVGMLLGFTTEKIGRMFTSAANTLRSCRDIGAYGLDVLKLIMKWFFPKAD
                     EESELAMVRSIEDAVLDMEAIENNHLTSLLKDRDSLATFMKTLDVEEEKARRLSTKSA
                     SPDIVGTINALLARISAARSLVHRAKEEMSNRVKPVVVMISGRPGIGKTHMARELARK
                     IGATMSGDQRVGLVPRNGVDHWDAYKGERIVLWDDYGMSNPVKDALTLQELADTCPVT
                     LNCDRIENKGKMFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDVEKAKR
                     DFPGQPDMWKGAFKDDSSHIKLSLAPQGGFDKNGNTPYGKGVMKTLTQASLTARVLGL
                     VHERIDEFELQGDTGAVYNFDNNKIGAFRKLAADNKYGLMETMRVGAKLQSVKNIDQL
                     RANLRDITIKPCLIIYNSSTYSLESNGKGNVVIKKVENQVVQSRNTIHTAILRMKQAK
                     IRYYIKCIQEAIYSLLQVAGASFVVARITRKFTRDAWSHWDNTPDQAPPVPTPPQDAS
                     WEIAAADVTPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKYSIEEYL
                     QDRDRFYEELTIAQATEENFGDDDEMRLRQRIFRPSKKQRKEERGVLGLVTGSEIRKR
                     KPDDFKPRGNLWADDNREVDYSAKIDFEAPPSVWSRIVNFGTGWAFWVSPSLLITSTH
                     VIPRGITEAFGVPIEQIQVHRSGEFCRFRFPKPIRPDVSGMILEEGAPEGTVCSILIK
                     RTTGEMMPLAVRMGTHATMKIQGRTVGGQMGMLLTGSNAKNMDLGTTPGDCGCPYIYK
                     RGNDYVVAGVHTAAARGGNTVVCATQGPEGEAALEGSGSFGTYCGAPILGVGDAPKLS
                     TKTKFWRSSTTPLPPGTYEPAYLGGKDPRVEGGPSLQQVMRDQLKPFTEPRGKMPKPA
                     TLESAKATIINVLDQTLDPPKKWTYAQACQSLDKTTSSGHPHHVRKNDHWNGDSFTGP
                     LADQASKANLMYEQGKHMQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGTMVRCAR
                     AFGGLLDELKANCINLPCRVGININEDGPAIFERHSRYTYHLDADYSRWDSTQQRAIL
                     ATAMEIMVRFSPEPELAQVVVEDLLSPSVLDIGDFKISVLEGLPSGVPCTSQWNSIAH
                     WLLTLCAISESTGLSPDVVQAYSCFSFYGDDEIISTDIEIKPEVLTEKLKSYGLIPTR
                     PDKSEGPLVISKDLSGLTFLRRTITRDPSGWFGKLDKDSILRQLYWTRGPNHDDPYET
                     MTTHSQRATQLMALLGEASLHGAAFYSKVSKLVVTEIKESGLEFYVPRQEAMFRWMRF
                     SDLSTWEGDRNLAPEGVNDDGIE"
     CDS             5064..6737
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AAX32880.1"
                     /translation="MMMASNDATAPTDGAAGLVPEVTNETMALEPVAGAALAAPVVGQ
                     HNVIDPWIRGNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVVLAGNAFAAGKIIFAAVPPSFPVDALSAPTITMCPHVIVDVRQLEPVLLPMPD
                     VRNNFFHYNQSSDPKLRLVAMLYTPLRANSPTDDVFTVSCRVLTRPSPDFEFTFLIPP
                     TVESKSKPFTIPQLTLSELSNSRFPAPIDMLYTSPNDNIVVQPQNGRCTLGGELQGTT
                     QLQPSLICSFRGVTLNETSRMLVDQEEEEEGEVQRPQARAFNHEYHLQLQNLDGTDYD
                     PAGDLPATLGAPDFIGTVYGVVSQRTTRDSAARAHEAKITTSDPRYAPKLGSVEFVTE
                     STDIVLNDQTKFTPVGLAHNRAVDYKQWELPHYAGELTANTNLAPPVAPVYPGEQLLF
                     FRSNLPLAGGTAASVLDCLLPQEWIQHFYQESFAPQSDIALLRYVNPDTGRVLFEAKL
                     HRQGYITVAGAGTSPVAVPPNGYFRFESWVSQFYTLAPMGSGTGRRRNQ"
     CDS             6737..7564
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2 small basic protein"
                     /protein_id="AAX32881.1"
                     /translation="MAGQIIAGIAADLFSSGLGSLINAGTNALNQKVEYDFNKKLQSA
                     SFAHDREMLQAQVAATRQLQQDMIKIKEDTLMLAGFSPSDAARGSVNAPMTKVLDWNG
                     TRYWAPGAMRTSSYSGRFSSQVPQTTFYKEPPKIPSSQAKPNPRPDPKPPATQQPQSA
                     PAPSGSSSGSGSVSSHSTQSTSLSTVRSPNSTLSRTASWVLSQNLEPFMPGSLNISGV
                     TPPSDTFSSRSSVSSRSSLSGTVSTVPKEILDSWTPAFNTRRQPLFARLRRRGESQV"
     3'UTR           7565..7612
ORIGIN      
        1 gtgaataatg atggcgtcta acgacgtcaa cgttgccgct ggcgacaaca ccaatggcaa
       61 tgaaaagcaa acaaaaatgc ccacctcggg catttttacc aacgtcaagg ttggtattaa
      121 aaagatcctg ggtgatcgcg attgcgatgc ccagcccccc gcccccacac cgcgggagaa
      181 accggagcca cccccccctc ctgaggaaac cgttgcgggg gaacccccac ctgagggctg
      241 tgtggcttat cacaaggatg gtgacaggat cgacgggctc cctaggggac ccgccgacgc
      301 cgaacccaag tgcatggctt atagcgcccc ccctccccac gaaagagaag atggacctgc
      361 aatggagccg ctcccaggct ccattcttga gatgtgggat ggtgaaatat atcactacgg
      421 gctctatgtc aacgacggcc tagttcttgg agtccaccgc cccgcatctg ccatttgcac
      481 cgccaccatt gagttaaccc cactctcact ctactggcgt gtggtgcacg ttcctcagaa
      541 cgttattcca tcagagacac tcaagcgctt ggctggagaa aagttcccct atacggcatt
      601 tgataacaat tgctatgcat tctgctgctg ggttttagac ttgaacgatt cctggctgtc
      661 ccgcaagatg ataaatcgta ccaccggctt ttacaaaccc tatcaggtct ggaacaggaa
      721 gcccctcccc accatggatg atggaaagat gaagaaagtg acaaatgttt tgctctgtgc
      781 cctatcttcc ctcttcaccc gcccgatcaa ggacgtgatc ggcagcttga agccccttaa
      841 tttacttaat ttgctggcat catgtgattg gacattcggt gggatcgtcg agaccctagt
      901 ccttgttggt gagctttttg ggatattctg gactcccccg gatgtttcag ccttccttgc
      961 ccccctgctt ggcgattatg agctccaggg gccccaagac ctggccacgg agcttgtgcc
     1021 catactcatg ggtggggtcg ggatgttgct tggtttcacc acagagaaga tagggcgcat
     1081 gttcacctca gcagcgaata ccctgcggtc gtgccgagac atcggggcct atgggctgga
     1141 cgtcctcaag ctaatcatga aatggttctt ccccaaggcc gatgaggaga gtgagcttgc
     1201 aatggtccgg tcaatagaag atgctgtgct agacatggag gctatcgaaa ataaccatct
     1261 cacctccttg cttaaagaca gggacagcct tgccaccttc atgaagacac ttgatgttga
     1321 ggaagaaaaa gcaagacgcc tctcaactaa gtcagcatct cctgacatag tgggaaccat
     1381 aaatgccctc cttgcgcgca tctctgcggc gcgctcccta gtacaccgag caaaggagga
     1441 aatgtccaac cgagtgaaac cggttgtggt tatgatctcg ggcaggcccg ggattgggaa
     1501 gacacacatg gcccgggaac tagcacggaa aatcggtgcc acgatgtcag gtgaccagag
     1561 agttgggttg gttccaagaa atggtgtcga tcactgggac gcctataagg gagaaaggat
     1621 agtcctgtgg gacgactatg gtatgagtaa ccctgttaag gatgccctga cactacagga
     1681 gttggccgac acctgccccg tgaccttaaa ttgtgacagg atagaaaaca aaggaaagat
     1741 gtttgatagt gatgtcatta taataacaac caatcttgca aaccctgccc ccttggacta
     1801 tgtcaacttt gaggcgtgtt cacgtcgcat agatttccta gtctatgctg aagcacctga
     1861 cgtggagaag gctaagaggg attttcctgg acagcctgac atgtggaagg gggcctttaa
     1921 agatgattcg tcccatatca aactttcact tgctccccaa ggtggctttg acaagaatgg
     1981 caacaccccc tacggcaagg gtgtcatgaa gaccctgact caggcctccc tcacggcacg
     2041 tgttctaggg ttagtccatg agagaattga tgaattcgaa ctgcagggtg atacgggtgc
     2101 cgtttacaac tttgataata ataagattgg ggcattcaga aagctcgcag ccgacaacaa
     2161 atacggcttg atggagacaa tgagagtggg ggccaaacta cagagtgtca agaacattga
     2221 ccaactccgc gccaacctgc gggacataac tatcaagccc tgcctgatta tttataatag
     2281 ttccacctac tccttagagt caaatggcaa aggcaatgtg gttatcaaga aggttgagaa
     2341 ccaggttgtc cagtccagaa acaccatcca cactgccatc ctcaggatga aacaagcaaa
     2401 gattaggtat tacatcaagt gtatccaaga ggcaatctac tccctgttgc aggtggcggg
     2461 ggcttcattt gtcgttgcaa ggatcacgcg gaaattcaca cgcgacgcgt ggtcccactg
     2521 ggacaacacc cctgaccagg ctccccccgt acccacacca ccacaggatg cctcctggga
     2581 aatagctgcc gccgatgtca cacccgaggg caagaaagga aagaacaaaa agggcagagg
     2641 aaagaaacac acagccttct caagtaaagg cctgagtgat gaggaatacg atgaatacaa
     2701 gaggatcagg gaggaaagaa atggtaagta ctctattgag gaatatctgc aagacaggga
     2761 ccgcttctat gaagagctca ccatagccca ggccactgaa gagaactttg gggatgatga
     2821 cgagatgcga ctcaggcaac gcatctttag accaagcaag aagcagcgca aagaggagcg
     2881 cggggttttg ggtctagtca caggttcaga gatccggaaa agaaaacccg atgacttcaa
     2941 accccgtgga aacctgtggg ccgatgataa cagagaggtg gactacagtg caaagataga
     3001 ttttgaggca cccccaagtg tttggtctcg cattgtcaac tttggcacgg gctgggcgtt
     3061 ttgggtctct cccagtctac tcataacatc aacacatgtt ataccaagag gtatcactga
     3121 agcctttggg gtgccaattg agcagatcca ggtccacaga tcaggggagt tttgtcgttt
     3181 ccgcttcccg aaacccatcc gacccgacgt ttcaggcatg attctagagg agggagcccc
     3241 tgagggcacc gtgtgttcca tcttgatcaa gagaacaact ggtgaaatga tgccgctcgc
     3301 tgtccgtatg ggaacccatg ctacgatgaa gatacaaggg cggacggtcg gcggtcaaat
     3361 gggaatgctg ctcactgggt ccaacgccaa gaacatggac ttgggcacga cccctggcga
     3421 ttgtgggtgt ccttacatct ataagagagg taacgactat gtggtggctg gagtccacac
     3481 agctgccgct aggggtggga acaccgtggt ctgtgccaca cagggccccg agggtgaggc
     3541 agctctggag ggtagtggaa gctttggcac ttactgtggg gcgccaatat tgggtgtagg
     3601 agacgctccc aaactcagca ccaaaaccaa attctggagg tcttcaacca ctcccctccc
     3661 gccagggact tatgagcctg cctaccttgg cgggaaagat ccccgtgtgg agggaggccc
     3721 ctcacttcag caggttatga gagaccaact caagcccttt acagaaccca gaggaaagat
     3781 gccaaaacct gctactcttg agtcggccaa ggccacgata atcaatgtct tagaccaaac
     3841 cctggatccc cccaagaaat ggacatatgc tcaggcctgt caatccctgg acaaaaccac
     3901 ctccagcggg cacccacacc acgtccggaa gaacgaccac tggaatggtg actctttcac
     3961 gggccccctc gctgaccaag catccaaggc caacttgatg tacgagcagg gcaagcatat
     4021 gcaaccagtc tatactgcag cgttgaaaga tgagcttgtg aagactgata agatctacaa
     4081 gaagatcaag aaacggctcc tttgggggtc tgacttaggg accatggtaa ggtgtgcacg
     4141 tgcctttggc gggctgctag atgaactcaa ggcaaactgc atcaacctgc cttgcagggt
     4201 tgggataaac atcaatgaag atggtcccgc catctttgag agacactcca gatacaccta
     4261 ccacctggat gctgattatt caagatggga ttcaacgcaa caaagggcca tccttgccac
     4321 ggccatggag atcatggttc gcttctcacc cgagcccgag cttgcccagg tggtggtcga
     4381 ggacctcctt tcacccagcg tccttgacat tggtgacttc aagatctcgg tccttgaagg
     4441 cctgccctca ggcgtccctt gcacatcaca gtggaactcc atagcgcatt ggcttctaac
     4501 actctgtgca atctctgagt caacagggct ttcccctgat gtggtgcaag cttactcgtg
     4561 cttctccttc tatggtgatg atgagatcat aagcacggac atagagatca aaccagaggt
     4621 tctcacagaa aagctcaaga gctatggttt aatacccacc agaccagaca aaagcgaggg
     4681 gccactagtc attagcaaag acctgtccgg gttgactttc ctgaggcgga ccataacccg
     4741 tgacccatca ggttggtttg gaaaattgga caaggactcc attttgaggc agctttactg
     4801 gaccaggggg cccaaccatg atgaccccta tgagaccatg accacacact cacagagagc
     4861 cacacagctt atggcactac ttggggaagc ctcattgcat ggcgcagcct tttacagcaa
     4921 ggtcagtaag ctagtggtga cagaaatcaa agaaagtggc ctggagtttt acgtgcccag
     4981 gcaagaggcc atgtttaggt ggatgaggtt ttctgacctc agcacgtggg agggcgatcg
     5041 caatctggct cccgagggtg tgaatgatga tggcatcgaa tgatgctacc gctccgactg
     5101 atggagctgc cggtctcgtc ccagaggtca ccaatgagac catggcactg gaacccgtcg
     5161 caggggcggc cttggccgcg cctgtcgtag ggcagcataa cgttattgac ccctggatta
     5221 gaggtaattt tgtgcaagcc cctaatggag aatttacagt ttccccccgt aattcccctg
     5281 gagaggtttt actaaatttg gaattaggcc ctgaattaaa cccttatctg gctcatcttg
     5341 cccgtatgta caacgggtac gctggtggaa tggaggttca ggtggtgctc gctgggaatg
     5401 cgttcgcagc ggggaaaatc atctttgctg ccgttccacc aagtttccca gttgatgctt
     5461 tgagcgcgcc cacgataaca atgtgccccc acgttatagt ggatgtgaga caactggagc
     5521 cagtattgct ccctatgcca gatgttagga ataatttctt tcattataac cagagttctg
     5581 accccaagct tcgattggtt gcaatgcttt atacgccctt gagagccaat agcccaactg
     5641 atgatgtgtt tactgtgtct tgtagagttc ttacgaggcc atcccctgat tttgagttca
     5701 cctttttgat accacccaca gttgagtcca aaagcaagcc ttttaccatt ccccagctta
     5761 ccttgtctga gttgtctaat tcaagatttc ctgcacccat tgatatgctt tatactagtc
     5821 ccaatgataa cattgtggtg cagccccaga atggaagatg cacacttggt ggtgaactac
     5881 aaggcacaac ccagctccaa ccaagcctta tctgctcctt tcgaggagtg accctcaatg
     5941 agacttcccg gatgttggtt gatcaagagg aagaggaaga gggggaggtt cagcgcccac
     6001 aagcccgcgc cttcaaccat gaataccatc ttcagctgca aaatttagat ggcactgact
     6061 atgaccctgc aggggatctc cccgcaacct taggggcacc tgactttatt gggacagtgt
     6121 atggagtggt tagtcagcgc accacccgtg atagtgcagc tagggcacat gaggccaaaa
     6181 tcaccactag tgaccccagg tatgctccca agcttggatc agttgagttc gtaacagagt
     6241 caacagatat tgtgctgaat gaccagacca agtttacccc tgttggtctt gcccataacc
     6301 gggcagttga ctacaagcag tgggagctgc cacattatgc aggggagctc acagccaaca
     6361 ccaatttagc ccctcctgtg gcgcctgttt accccggtga acaattgctt ttcttccgct
     6421 caaaccttcc ccttgcaggt ggtacagccg caagtgttct tgattgtctt ttgccccaag
     6481 agtggattca acatttttat caggaatcat tcgcccccca gtctgacatt gcactcctga
     6541 ggtatgtgaa ccccgacaca ggtagagttc tctttgaagc aaaattgcac cgacagggtt
     6601 acataactgt ggctggtgct ggcaccagtc ctgtggccgt gcctccaaac ggctatttta
     6661 ggtttgagtc ttgggtatca cagttttata cactagcccc catgggatct ggaacggggc
     6721 gcaggaggaa tcagtaatgg cggggcaaat tatagccggg attgctgctg atctgtttag
     6781 ttctggactt ggctcactta ttaatgctgg tactaatgcc cttaatcaaa aggtggaata
     6841 tgattttaat aagaaattac agtctgcttc ttttgctcat gatagggaaa tgctgcaggc
     6901 gcaggtcgca gccacacggc aactgcagca agatatgatt aagatcaagg aagacacact
     6961 catgctcgcc ggcttctctc catcagatgc ggcgcggggt tctgtaaacg ccccaatgac
     7021 taaggtcctt gactggaacg gtactaggta ctgggctcca ggtgctatgc gcacctcatc
     7081 ttattctggg cggttttcct ctcaagtgcc ccagaccacc ttttataagg aaccacccaa
     7141 gataccatct agccaggcga agcctaatcc acggccggac cccaagccac ctgcgactca
     7201 gcaaccgcag tcagcccctg ctccttccgg gagcagttcc ggttcaggat cagtctcgtc
     7261 tcactctacc cagtcaacct ccctttccac tgtgcgttcc cccaattcaa cactgtcacg
     7321 gaccgcgagt tgggttctct cacagaatct tgagcctttt atgccgggct cactgaacat
     7381 cagcggtgtg actccaccat ctgatacttt ttctagtaga tcatcagttt cttctagatc
     7441 ttcactttcg ggaacggtct caaccgtccc caaagagatt ttggactcct ggacacctgc
     7501 atttaacaca cgcaggcaac cgctctttgc tcgcctccgc aggagggggg agtcacaagt
     7561 ttagtgaaaa gttatctttg ttttcctttt ccttttctgt ttggtaactt tt
//