Typing tool

Complete norovirus genomes

AY741811  GII.4 US95
 GII.P4 US95

Length: 7,555 | 3 CDS

ORF1: 4..5103
ORF2: 5084..6703
ORF3: 6703..7509
LOCUS       AY741811                7555 bp ss-RNA     linear   VRL 30-JUN-2006
DEFINITION  Norovirus Hu/NLV/Dresden174/pUS-NorII/1997/GE, complete genome.
ACCESSION   AY741811
VERSION     AY741811.1
KEYWORDS    .
SOURCE      Norovirus Hu/NLV/Dresden174/pUS-NorII/1997/GE
  ORGANISM  Norovirus Hu/NLV/Dresden174/pUS-NorII/1997/GE
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7555)
  AUTHORS   Rohayem,J., Robel,I., Jager,K., Scheffler,U. and Rudolph,W.
  TITLE     Protein-Primed and De Novo Initiation of RNA Synthesis by Norovirus
            3Dpol
  JOURNAL   J. Virol. 80 (14), 7060-7069 (2006)
   PUBMED   16809311
REFERENCE   2  (bases 1 to 7555)
  AUTHORS   Scheffler,U. and Rohayem,J.
  TITLE     Generation and characterization of a norovirus full-lenth clone
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7555)
  AUTHORS   Scheffler,U. and Rohayem,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2004) The Calicilab, Institute of Virology,
            Fetschestrasse 74, Dresden, Saxony 01307, Germany
FEATURES             Location/Qualifiers
     source          1..7555
                     /organism="Norovirus Hu/NLV/Dresden174/pUS-NorII/1997/GE"
                     /mol_type="genomic RNA"
                     /isolate="Hu/NLV/Dresden174/pUS-NorII/1997/GE"
                     /db_xref="taxon:296145"
                     /country="Germany"
     CDS             4..5103
                     /note="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AAU95775.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEIVVSYSVKDGVSGLPELSTVRQPE
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLILGVHKPPAATS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGKQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PDLKQALKNISIKKCQIVYSGCTYTLESDGKGNAKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVEDTGEAINKDGC
                     PKPKDDEEFVISSDDIKTEGKKGRNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRENDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFTQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRRARAFGGLMDELKTHCVTLPIRVGMNMNEDGSIIFERHSRHKYHYDADYSRWD
                     STQQRAVLAAALVIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     KYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTGGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5084..6703
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AAU95776.1"
                     /translation="MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLKANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICTFRGDVTHIAGSHDYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTREDGSTRAHKATVSTGSVHFTPKLGSVQYTTDTNNDFQTGQNTKFTPVGVIQDG
                     NNHQNEPQQWVLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGPHDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     CDS             6703..7509
                     /note="ORF3"
                     /codon_start=1
                     /product="putative structural protein"
                     /protein_id="AAU95777.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLHKASFQHDKEMLQAQIEATNKLQQGMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRTNLRATVPARGSSSRLS
                     STPTATSVYSNQTVSTRLGSSAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgcttcc gctgccgctg ttgccaacag caacaacgac
       61 accgcaaaat cttcaagtga cggagtgctt tctagcatgg ctgtcacttt taaacgagcc
      121 ctcggggcgc ggcctaaaca gccccccccg agggaaatac cacaaagacc cccacgacca
      181 cccaccccag aactggtcaa aaagatcccc cctcccccgc ccaacgggga ggatgaaata
      241 gtggtttctt atagtgtcaa agatggcgtt tccggtctgc ctgagctttc caccgtcagg
      301 caaccggaag aagccaatac ggctttcagt gtccccccac tcaaccagag ggagaatagg
      361 gatgctaagg agccactgac tggaacaatt ctggaaatgt gggatggaga gatctaccat
      421 tacggcctat atgtggagcg aggtcttata cttggtgtgc acaaaccacc agctgccact
      481 agcctcgcca aggtcgagct aacaccactc tccttgttct ggagacctgt gtatactccc
      541 cagtatctca tctctccaga cactctcaag aaattacacg gagaatcgtt tccctacaca
      601 gcctttgaca acaattgcta tgccttctgt tgctgggtct tggacctaaa cgactcgtgg
      661 ctgagtagga gaatgatcca gagaacaact ggtttcttca gaccctacca agattggaat
      721 aggaaacccc tccccactat ggatgattcc aaattaaaga aggtagctaa tatattcctg
      781 tgtgctctgt cttcactatt caccaggccc ataaaagaca taatagggaa gctaaggcct
      841 cttaacatcc tcaacatctt ggcctcatgt gattggactt tcgcaggcat agtggaatcc
      901 ttgatactct tggcagagct ctttggagtt ttctggacac ccccagatgt gtctgcgatg
      961 attgccccct tactcggtga ttacgagtta caaggacctg aggaccttgc agtggaactc
     1021 gttcctgtag tgatgggggg aattggtctg gtgctaggat ttaccaaaga gaagattgga
     1081 aaaatgttgt catctgctgc atccacctta agagcttgta aagatcttgg tgcgtacggg
     1141 ctggaaatcc taaagttagt catgaagtgg ttcttcccaa agaaagagga agcaaatgaa
     1201 cttgctatgg tgagatccat cgaggatgca gtgctggacc tcgaggcaat tgaaaacaac
     1261 catatgacca ccttgctcaa agacaaagac agtctggcaa cctacatgag aacccttgac
     1321 cttgaggagg agaaagccag gaagctctca accaagtccg cttcacctga catcgtgggc
     1381 acaatcaacg cccttctggc gagaatcgct gctgcacgtt ccctggtgca tcgagcgaag
     1441 gaggagcttt ccagcagacc aagacctgtt gtcttgatga tatcaggcag accaggaata
     1501 gggaagaccc accttgctag ggaagtggcc aagagaatcg cagcctccct cacaggaaaa
     1561 cagcgtgtag gcctcgtccc acgcaatggc gtcgatcact gggatgcata caagggggag
     1621 agggtcgtcc tatgggacga ctatgggatg agcaatccca tccacgatgc cctcaggttg
     1681 caagaactcg ctgacacttg ccccctcact ctaaactgtg acaggattga gaacaaagga
     1741 aaggtctttg acagtgatgt cataattatc accactaatc tggccaaccc agcaccactg
     1801 gactatgtca actttgaagc atgctcgagg cgcatcgatt tcctcgtgta tgcagaagcc
     1861 cctgaagtcg aaaaggcgaa acgtgacttc ccaggccaac ctgacatgtg gaagaacgct
     1921 ttcagttctg atttctcaca cataaaacta acactggctc cacagggtgg cttcgataag
     1981 aacgggaaca ccccacacgg gaagggcgtc atgaagactc tcaccactgg ctcccttatt
     2041 gcccgggcat cagggctact ccatgagagg ctagatgagt ttgaactaca gggcccagct
     2101 ctcaccacct tcaactttga tcgcaacaaa gtgcttgcct ttaggcagct tgctgctgaa
     2161 aacaaatacg ggttgatgga cacaatgaaa gttggaaggc agctcaagga tgtcagaacc
     2221 atgccagatc ttaaacaagc actcaagaat atctcaatca agaagtgcca gatagtgtac
     2281 agtggttgca cctatacact tgagtctgat ggcaagggca atgcgaaagt tgatagagtt
     2341 cagagcgcct ccgtgcagac caacaacgag ctggccggcg ccctacacca tctaaggtgc
     2401 gccagaatca ggtactatgt caagtgtgtc caggaggccc tgtattccat catccaaatt
     2461 gctggagctg catttgtcac cacgcgcatc gccaagcgca tgaacataca agacctctgg
     2521 tccaagccac aagtggaaga cacaggggag gctatcaaca aggacgggtg cccaaaaccc
     2581 aaagatgatg aggagtttgt catttcatcc gacgatatca aaactgaggg caagaaaggg
     2641 aggaacaaga ctggccgcgg caagaagcac acagccttct caagcaaagg tctcagtgat
     2701 gaagagtacg acgagtacaa gaggattaga gaagaaagaa atggcaagta ctccatagaa
     2761 gagtaccttc aggacaggga caaatactat gaggaggtgg ccattgccag ggcgaccgag
     2821 gaagacttct gtgaagagga ggaggccaag attcggcaaa ggattttcag gccaacaagg
     2881 aaacaacgca aggaggaaag ggcctctctc ggtttagtca caggttctga aatcagaaaa
     2941 aggaacccag atgacttcaa gcccaagggg aaactgtggg ctgatgatga cagaagtgtg
     3001 gactacaatg agaaactcag ttttgaggcc ccaccaagca tctggtcgag gatagtcaac
     3061 tttggttcag gttggggctt ttgggtctcc cccagtctgt tcataacatc aacccatgtc
     3121 ataccccagg gcgcaaagga gttctttgga gtctccatca agcaaatcca gatacacaaa
     3181 tcaggcgaat tctgtcgctt gagattccca aaaccaatca ggactgatgt gacgggcatg
     3241 atcttagaag aaggtgcgcc cgaaggcacc gtggccacac tactcatcaa gaggcctact
     3301 ggagaactta tgcccctagc agctagaatg gggacccatg caaccatgaa aattcaaggg
     3361 cgcactgttg gaggtcagat gggcatgctt ctgacaggat ccaacgccaa aagcatggac
     3421 ctaggcacca caccaggtga ctgcggctgc ccctacatct acaagaggga aaatgactat
     3481 gtggttattg gagtccacac ggctgccgct cgtgggggaa acactgtcat atgtgccact
     3541 caggggagtg agggggaggc tacacttgaa ggtggtgaca gtaagggaac atactgtggt
     3601 gcaccaatcc taggcccggg gagtgcccca aaactcagca ccaagaccaa attctggaga
     3661 tcgtccacaa caccactccc acctggcacc tatgaaccag cctatcttgg tggtaaggac
     3721 cccagagtca agggtggccc ttcattgcaa caagttatga gggatcagtt gaaaccattt
     3781 acagagccca ggggcaaacc accaaagcca agtgtgttgg aagctgccaa gaaaaccatc
     3841 atcaatgtcc ttgaacaaac aattgatcca cctgagaaat ggtcattcac gcaagcttgc
     3901 gcgtcccttg acaagactac ttccagtggc catccgcacc acatgcggaa aaacgactgc
     3961 tggaacgggg agtccttcac aggcaagctg gcagaccagg cttccaaggc caacctgatg
     4021 ttcgaagagg ggaagaacat gaccccagtc tacacaggtg cgcttaagga tgagttagtt
     4081 aaaactgaca aaatttatgg taagatcaag aagaggcttc tctggggttc ggacttagcg
     4141 accatgatcc ggcgcgctcg agcattcgga ggcttaatgg atgaactcaa aacacactgt
     4201 gttacacttc ctatcagagt tggtatgaat atgaatgagg acggttcgat catcttcgag
     4261 aggcattcca ggcacaaata tcattatgat gctgattact ctcggtggga ttcaacacaa
     4321 caaagggccg tgttggcagc agccttagta atcatggtta aattctcctc agaaccacat
     4381 ttggctcagg tagtcgcaga agaccttctt tctcctagcg tggtggatgt gggcgacttc
     4441 aagatatcaa tcaatgaggg tctcccctct ggggtgccct gcacctccca atggaactcc
     4501 atcgcccact ggcttctcac tctctgtgcg ctctctgaag ttacaaactt atcccctgac
     4561 atcatacagg ctaattccct cttctccttt tatggtgatg atgaaattgt tagtacagat
     4621 ataaagttgg acccagagaa attgacagca aagctcaaga aatacgggtt gaaaccaacc
     4681 cgccctgaca aaactgaagg gccccttgtt atttctgaag acttaaatgg tctgaccttc
     4741 ctgcggagaa ctgtgacccg cgacccagct ggttggtttg gaaaattgga gcagagttca
     4801 atactcagac aaatgtactg gactgggggc cccaaccatg aagacccatc tgaaacaatg
     4861 attccacatt cccaaagacc catacaattg atgtccctac tgggagaggc cgcgctccac
     4921 ggcccagcat tctacagcaa aataagcaag ttagttattg cagagctaaa agaaggtggc
     4981 atggattttt acgtgcccag acaagagcca atgttcagat ggatgagatt ctcagatctg
     5041 agcacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgaa
     5101 tgacgccaac ccatctgatg ggtccacagc caacctcgtc ccagaggtca acaatgaggt
     5161 tatggctttg gagcccgttg ttggtgccgc tattgcggca cctgtagcgg gccaacaaaa
     5221 tgtaattgac ccctggatta gaaataattt tgtacaagcc cctggtggag agtttacagt
     5281 atcccctaga aacgctccgg gtgagatact atggagcgcg cccttgggcc ctgatttgaa
     5341 cccttacctt tctcatttgg ccagaatgta caatggttat gcaggtggct ttgaagtgca
     5401 ggtaatcctc gcggggaacg cgttcaccgc cgggaaagtc atatttgcag cagtcccacc
     5461 aaattttcca actgaaggct tgagccccag ccaggttact atgttccccc atataatagt
     5521 agatgttagg caactggaac ctgtgttgat ccccttacct gatgtcagga acaatttcta
     5581 tcattacaat caatcaaatg attccaccat taaattgata gcaatgctgt atacaccact
     5641 taaggctaat aatgctgggg atgatgtctt cacagtctct tgtcgagtcc tcacaaggcc
     5701 atcccccgat tttgatttta tatttttggt gccacccaca gttgaatcaa gaactaaacc
     5761 gttcaccgtc ccaatcctaa ctgttgagga aatgtccaat tcaaggttcc ccatcccttt
     5821 ggaaaagttg tacacgggtc ccagcagtgc ttttgtcgtc caaccacaaa atggcaggtg
     5881 cacgactgat ggtgtgctct taggcactac ccagctgtct gctgtcaaca tctgcacctt
     5941 cagaggggat gtcacccaca ttgcaggcag tcatgattat acaatgaatt tggcttctca
     6001 aaattggaac aattatgacc caacagaaga aatcccagcc cctctgggaa ctccagattt
     6061 cgtgggaaag atccaaggca tgctcaccca aaccacaaga gaggatggct cgacccgcgc
     6121 ccacaaagct acagtgagca ctgggagtgt ccactttact ccaaagctgg gcagtgtcca
     6181 atacaccact gacacaaaca atgattttca aactggccaa aacacgaaat tcaccccagt
     6241 cggcgtcatc caggacggta ataaccatca aaatgaaccc caacaatggg tgctcccaaa
     6301 ttactcaggt agaactggtc ataatgtaca cctagctcct gccgttgccc ccacttttcc
     6361 gggtgagcaa cttcttttct ttaggtccac tatgcccggg tgtagcgggt atcctaacat
     6421 gaatctggat tgcctactcc cccaagaatg ggtgcagcac ttctaccaag aagcagctcc
     6481 agcacaatct gatgtggctc tgctgagatt tgtgaatcca gatacaggta gggttctgtt
     6541 tgagtgcaag cttcataaat caggctatgt cacagtggct cacactggcc cgcatgattt
     6601 ggttatcccc cccaatggtt acttcagatt tgattcctgg gtcaaccagt tctacacact
     6661 cgcccccatg ggaaatggag cggggcgtag acgtgcatta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgaatttgaa aataacagaa aattgcaaca agcttccttc
     6841 caatttagta gcaacctaca caaggcttct ttccaacatg ataaagagat gctccaagca
     6901 caaattgagg ccactaacaa attgcaacag ggtatgatga aagttaaaca ggcgatgctc
     6961 ctagagggtg gattctctga aacagatgca gcccgtgggg caatcaacgc ccccatgaca
     7021 aaggctctgg actggagcgg aacaaggtac tgggctcctg atgccaggac cacaacatac
     7081 aatgcaggcc gcttttccac ccctcaacct tcgggggcat tgccaggaag aactaatctt
     7141 agggctactg tccccgctcg gggttcctct agtagacttt ctagtactcc cactgctact
     7201 tctgtgtatt caaatcaaac tgtttcaacg agacttggtt cttcagctgg ttctggtacc
     7261 agtgtctcga gtctcccgtc aactgcaagg actaggagct gggttgagga tcaaaacaga
     7321 aatttgtcac cttttatgag gggggctctc aacacatcat ttgtcacccc tccatctagt
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aaattttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggtgtaat gtgaaaagac aaaattgatc atctttccat tctttagtgt ctttt
//