Typing tool

Complete norovirus genomes

AY587989  GII.4 Farmington Hills
 GII.P4 Farmington Hills

Length: 7,558 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       AY587989                7558 bp    RNA     linear   VRL 16-SEP-2004
DEFINITION  Norovirus Hu/NLV/Oxford/B2S16/2002/UK, complete genome.
ACCESSION   AY587989
VERSION     AY587989.1
KEYWORDS    .
SOURCE      Norovirus Hu/NLV/Oxford/B2S16/2002/UK
  ORGANISM  Norovirus Hu/NLV/Oxford/B2S16/2002/UK
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7558)
  AUTHORS   Dingle,K.E.
  CONSRTM   Norovirus Infection Control in Oxfordshire Communities Hospitals
  TITLE     Mutation in a Lordsdale norovirus epidemic strain as a potential
            indicator of transmission routes
  JOURNAL   J. Clin. Microbiol. 42 (9), 3950-3957 (2004)
   PUBMED   15364974
REFERENCE   2  (bases 1 to 7558)
  AUTHORS   Dingle,K.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-APR-2004) Nuffield Department of Clinical Sciences,
            Oxford University, Microbiology Level 6, John Radcliffe Hospital,
            Oxford, Oxfordshire OX3 0SA, UK
FEATURES             Location/Qualifiers
     source          1..7558
                     /organism="Norovirus Hu/NLV/Oxford/B2S16/2002/UK"
                     /mol_type="genomic RNA"
                     /isolate="Hu/NLV/Oxford/B2S16/2002/UK"
                     /db_xref="taxon:272576"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AAT00251.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARS
                     KQPPPRETPQRPPRPPTPELVKKIPPPPPNGEDEIVISYSVKDGVSGFPELSTVRQPE
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVDRGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTVDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTSNELTGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEEVTNKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWD
                     STQQRAVLASALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AAT00252.1"
                     /translation="MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGTHNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGRIQGML
                     TQTTRGDGSTRGHKATVSTGDVHFTPKLGSIQFNTDTNNDFETGQNTRFTPVGVVQDG
                     NGTHQNEPQQWVLPSYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="AAT00253.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLISAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQGMMEVKRAMLLEGGFSETDASRGAIN
                     APMTKALDWSGTRYWAPDARTTTYNTGRFSTPQPSGALPGRTNPRATVPARGFSNAPS
                     NTSTATSVYSNQTVSTRLGSTAGSGTSVSSLPSTARTRSWIEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggtctaaac agcccccccc gagggaaaca ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc tcctcccccg cccaacggag aggatgaaat
      241 agtgatttct tatagtgtca aagatggcgt ttccggtttt cctgagcttt ccaccgttag
      301 gcaaccggaa gaagctaata cggccttcag tgtccccccg ctcaatcaga gggagaatag
      361 ggatgctaag gagccactga ctggaacaat tctggaaatg tgggatgggg aaatctacca
      421 ttacggcctg tatgtggatc gaggtcttgt actaggcgtg cacaaaccac cagctgccat
      481 tagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtatactcc
      541 tcagtacctc atctctccag acactctcaa gaaattacac ggagaaacat tcccttacac
      601 agcctttgac aacaattgct atgccttttg ctgctgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agaggacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccactg tggatgattc caagttaaag aaggtagcta atatattcct
      781 gtgtgctctg tcttcgctgt tcaccaggcc cataaaagac ataataggga agctaaagcc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ctggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg actacgagtt acaaggaccc gaggaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctggga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg cgtccacctt gagagcttgc aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtgctggac ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaat gcccttctgg cgagaatcgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggtt
     1681 gcaagaactc gctgacactt gccccctcac cctaaactgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaac ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgat ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga agcgtgactt cccaggccaa cctgacatgt ggaagaacgc
     1921 ctttagttct gatttttcac acataaaact agcactggct ccacagggtg gcttcgataa
     1981 aaacgggaac accccgcacg ggaagggcgt catgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgag tttgaactac agggcccagc
     2101 tctcaccacc ttcaactttg atcgcaacaa agtgcttgcc tttaggcaac ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgag agttgggagg cagctcaagg atgtcagaac
     2221 catgccagag cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agatagtgta
     2281 cagtggttgc acctacacac ttgagtctga cggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcacc tctgtgcaga ccagcaatga gctgactggc gccctgcacc acctaaggtg
     2401 tgccagaatc aggtactatg tcaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaaacgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaag acacagagga ggtcaccaac aaggacgggt gcccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc cgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag actggtcgcg gcaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agaggattag agaagagagg aatggcaagt attccataga
     2761 agagtacctc caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccaacaag
     2881 aaaacaacgc aaggaggaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaaccca gatgatttca agcccaaggg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gctttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 atcaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggtat
     3241 gatcttagaa gaaggtgcgc ctgaaggcac cgtggtcaca ctactcataa aaaggcctac
     3301 aggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga aaattcaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tctaacgcca aaagcatgga
     3421 cctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatc ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggagt gagggggagg ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaagacca aattctggag
     3661 atcgtccaca gcaccacttc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccccagggtc aagggtggcc cttcattgca gcaagtcatg agggatcagt tgaaaccatt
     3781 tacagagccc aggggaaagc caccaaagcc aagtgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcattcg cacaagcttg
     3901 cgcgtccctc gacaagacca cttccagtgg ccatccgcat cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagct ggcagatcag gcttccaagg ccaacctgat
     4021 gttcgaagaa gggaagaaca tgaccccagt ctacacaggt gcgcttaagg atgaattggt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttagc
     4141 gaccatgatc cgatgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgttacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatattcga
     4261 gaggcattcc aggtacagat atcactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagct gtgttggcat cagctctaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtagtcgcag aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 cacaatatca atcaacgagg gcctcccctc tggggtaccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgcgc gctctctgaa gttacaaatc tgtcccctga
     4561 catcatacag gctaattccc tcttctcctt ttatggtgat gatgaaatcg ttagcacaga
     4621 cataaaattg gacccagaga agttgacagc aaagctcagg gaatatgggc tgaaaccaac
     4681 ccgccctgac aaaactgaag ggccccttgt tatctctgaa gacttaaatg gtctgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacagtt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cctgatctga
     5341 atccctacct ttctcatttg gccagaatgt acaatggcta tgcaggtggc tttgaagtgc
     5401 aggtaatcct tgcggggaat gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc catataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccttacc tgatgttagg aacaatttct
     5581 accattacaa ccaatcaaat gaccccacca ttaaattgat agcaatgctg tacacaccac
     5641 ttagggctaa taatgctggg gaagatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccccga ttttgatttc atatttttgg tgccacccac agttgagtca agaactaaac
     5761 cattcaccgt cccaatttta actgttgagg aaatgaccaa ttcaagattc cctattcctt
     5821 tggaaaagtt gttcacgggt cctagcggtg cctttgttgt tcaaccacaa aatggcaggt
     5881 gcacgactga tggcgtactc ttaggcacta cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat attgcaggta ctcataatta cacaatgaat ttggcttctc
     6001 aaaattggaa caattatgac ccaacagaag aaatcccagc ccctctgggg accccagatt
     6061 tcgtgggaag gatccaaggc atgctcaccc aaactacaag gggagatggc tctacccgcg
     6121 gccacaaagc tacagtgagc actggggatg tccacttcac tccaaagcta ggcagtattc
     6181 agttcaacac tgatacaaac aatgattttg aaactggcca aaacacgaga ttcaccccag
     6241 ttggtgttgt ccaggatggt aatggcaccc accaaaatga acctcaacaa tgggtgctcc
     6301 caagctactc aggtagaact ggtcataatg tacacctagc ccccgccgta gcccccactt
     6361 ttccgggtga gcaacttctt ttcttcaggt ccactatgcc cggatgcagc gggtacccca
     6421 acatgaattt ggattgtcta ctcccccaag aatgggtgca gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttc
     6541 tatttgagtg caagcttcat aaatcaggct atgtcacagt ggctcacact ggccagcatg
     6601 atttggttat cccccccaat ggctacttta gatttgattc ctgggtcaac caattctaca
     6661 cacttgcccc catgggaaat gggacggggc gtagacgtgc attataatgg ctggagcttt
     6721 cttcgccggg ctggcatctg atgtccttgg ctctggactt ggttccctaa tcagtgctgg
     6781 ggctggggcc atcaaccaaa aagttgagtt tgaaaataac aggaaattgc aacaagcttc
     6841 cttccaattt agtagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acagggtatg atggaagtta aacgggcaat
     6961 gctcctagag ggtggattct ctgaaacaga tgcatcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggct cctgatgcta ggactacaac
     7081 atacaacaca ggccgctttt ccacccctca accctcgggg gcactgccag gaaggaccaa
     7141 tcccagggct actgtccccg ctcggggctt ctccaatgca ccttctaata cttctactgc
     7201 tacttctgtg tattcaaatc aaactgtttc aacgagactt ggttctacag ctggctctgg
     7261 caccagtgtc tcgagtctcc cgtcaactgc aaggactagg agctggattg aggatcaaaa
     7321 caggaatttg tcacctttca tgaggggggc tcacaacata tcgtttgtca ccccaccatc
     7381 tagtagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggcg taatgtgaaa agacaaaatt gattatcttt cctttcttta gggtcttt
//