Typing tool

Complete norovirus genomes

AY237415  GII.10
 GII.P12

Length: 7,541 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7507
LOCUS       AY237415                7541 bp    RNA     linear   VRL 05-MAR-2004
DEFINITION  Human calicivirus strain Mc37, complete genome.
ACCESSION   AY237415
VERSION     AY237415.2
KEYWORDS    .
SOURCE      Human calicivirus strain Mc37
  ORGANISM  Human calicivirus strain Mc37
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7541)
  AUTHORS   Hansman,G.S., Katayama,K., Maneekarn,N., Peerakome,S., Khamrin,P.,
            Tonusin,S., Okitsu,S., Nishio,O., Takeda,N. and Ushijima,H.
  TITLE     Genetic diversity of norovirus and sapovirus in hospitalized
            infants with sporadic cases of acute gastroenteritis in Chiang Mai,
            Thailand
  JOURNAL   J. Clin. Microbiol. 42 (3), 1305-1307 (2004)
   PUBMED   15004104
REFERENCE   2  (bases 1 to 7541)
  AUTHORS   Hansman,G.S., Maneekarn,N., Peerakome,S., Khamrin,P., Tonusin,S.,
            Okitsu,S., Nishio,O. and Ushijima,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-FEB-2003) Developmental Medical Sciences, Tokyo
            University, 7-3-1 Hingo, Bunkyo-Ku, Tokyo 113-0033, Japan
COMMENT     On Mar 1, 2004 this sequence version replaced AY237415.1.
FEATURES             Location/Qualifiers
     source          1..7541
                     /organism="Human calicivirus strain Mc37"
                     /mol_type="genomic RNA"
                     /strain="Mc37"
                     /db_xref="taxon:235136"
     CDS             5..5104
                     /note="helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AAS47823.1"
                     /translation="MKMASNDASAAAAANSNNDTAKSSSDGMLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPHNGEDEPVVTYSVKDGVSGLPELTTVRQPG
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRKLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWSFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGRQLKDVRTM
                     PELKQALKSISIKRCQIVYSGCTYMLESDGKGEVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCIQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETASKDGC
                     PKPKDDDEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPNLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6731
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid"
                     /protein_id="AAP79906.2"
                     /translation="MKMASNDAAPSSDGAAGLVPESNNEVMALEPVAGASLAAPVTGQ
                     TNIIDPWIRMNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     MEVQIMLAGNAFTAGKLIFAAVPPHFPIENLSPPQITMFPHVIIDVRTLEPVLLPMPD
                     IRNSFFHFIQRDEPKMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFDFTYLVPP
                     TVESKSKPFTLPILTLGELTNSRFPLPIDVLYTNPNESAIVQCQNGRCTLDGELQGTT
                     QLLPTGICAFRGKVTQQVQDEHRGTHWNMTVTNLNGTPFDPTEDVPAPLGTPDFSGQI
                     YGVISQRNTNTVPGEGNLPANRAHEAVIATYSPKFTPKLGNIQFSTWETQDVSSGQPT
                     KFTPVGLASVDANSHFDQWTLPSYSGALTLNMNLAPSVAPVFPGECLLFFRSFIPLKG
                     GYGNPAIDCLMPQEWVQHLYQESAPSLSDVALVRYVNPETGRTLFEAKLHRNGFLTVA
                     RNSAGPVVAPTNGYFRFDSWVNQFYTLAPMGNGSGRRRMQ"
     CDS             6731..7507
                     /note="ORF3"
                     /codon_start=1
                     /product="unknown"
                     /protein_id="AAS47824.1"
                     /translation="MAGAFIAGLAGDVLSNGIGSLINAGANAINQKAEFDFNRQLQQN
                     SFNHDKEMLQAQIQATKQLQADMIAIKQGVLTAGGFSPTDAARGAVNAPMTQALDWSG
                     TRYWAPGAMRTSSYSGRFLSTTPTRQVEFPQRKSAAPSSADSTYSGSSRSTVSTTLGS
                     SASSSSRISPSTHSSLISGTSSSRSRTSDWVREQNRSLEPFMHGALQTAYVTPPSSRA
                     SSNGTVSTVPKGVLDSWTPAFNTRRQPLFAYLRPKGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctaata gcaacaacga
       61 caccgcaaaa tcttcaagtg acggaatgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggca cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acccacccca gaactggtca aaaagatccc tcctccccca cacaacgggg aggatgaacc
      241 agtggttact tacagcgtca aagatggcgt ttccggcttg cctgagctca ctactgtcag
      301 gcagccgggt gaagccaaca cggcgttcag tgttccccca ctcaaccaaa gggagaatag
      361 ggatgccaag gagccactaa ctggaacaat cctggaaatg tgggacgggg agatctacca
      421 ttacggcctg tatgtggaac gaggtcttgt acttggtgtg cacaaaccac cggctgccat
      481 cagcctcgcc aaggttgaac taacaccact ctctctgttt tggagaccag tgtatacacc
      541 acagtatctc atctccccgg acactctcag gaaactgcac ggagagtcgt ttccctacac
      601 agcctttgat aacaactgct atgccttctg ttgttgggtc ctggacttaa atgactcgtg
      661 gttgtgcagg agaatgatcc agaggacaac tggtttcttc aggccctacc aagactggaa
      721 taggaaaccc cttcccacca tggatgactc caagttgaag aaggtagcta acatattctt
      781 gtgcgcgcta tcttcgctat tcactaggcc catcaaagac ataataggaa aggtgaggcc
      841 tctcaacatc cttaacatct tggcctcatg tgattggtct ttcgcaggca tagtggaatc
      901 tttgattctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgcccct ttactaggtg actacgagct gcagggaccc gaggaccttg cagtggaact
     1021 cgttccagta gtaatggggg ggattggttt ggtgctagga ttcaccaaag agaagatcgg
     1081 gaaaatgttg tcatctgctg catccacctt aagagcttgt aaagatcttg gtgcatacgg
     1141 actggaaatc ttaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgaggtcca tcgaggatgc ggtgctggac ctcgaggcaa ttgagaacaa
     1261 ccacatgact gccctcctca aagacaaaga cagcctggca acctacatga gaactcttga
     1321 cctcgaggag gagaaagcca gaaagctttc aaccaagtct gcttcacctg atatcgtggg
     1381 cacaatcaac gctctcctgg cgagaatcgc cgctgcacgc tccctggtgc atcgggcgaa
     1441 agaggagctc tccagcagac caagacctgt tgttgtgatg atatcaggca ggccaggtat
     1501 agggaaaacc caccttgcca gggaattggc caagagaatc gctgcttctc tcacagggga
     1561 ccagcgtgtg ggtctcatcc cgcgcaatgg tgttgatcac tgggacgcat ataagggaga
     1621 aagagtcgtt ctatgggacg actatggaat gagtaacccc atccacgacg ccctcaggtt
     1681 acaagaactt gctgacacct gccccctcac gctaaattgt gataggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaac ctggccaacc cagcaccact
     1801 ggactatgtc aattttgaag cgtgctcgag gcgcatcgac ttcctcgtgt atgcagatgc
     1861 ccctgaggtc gagaaggcaa aacgtgactt tccaggtcaa cctgacatgt ggaagaacgc
     1921 tttcagttct gacttctcgc acataaaact gacgctggct ccgcagggtg gcttcgacaa
     1981 gaacggaaac accccacatg ggaaaggcgt catgaaaact ctcactactg gttccctcat
     2041 cgctcgagca tcagggctac tccatgagag gttagatgag tacgagctgc agggcccaac
     2101 ccccaccacc ttcaactttg accgcaacaa ggtgcttgcg ttcagacagc ttgctgctga
     2161 aaacaagtac gggttgatgg acacaatgag agtcggaaga cagctcaaag atgtcaggac
     2221 catgccagaa ctcaaacaag cactcaagag tatctcaatc aagagatgcc agatagtgta
     2281 tagtggctgc acctatatgc ttgagtctga tggcaagggt gaagtgaaag ttgacagagt
     2341 tcagaacgcc actgtgcaga ccaacaatga actggccggt gccctacacc atcttcggtg
     2401 tgccagaatt agatactatg tcaagtgcat tcaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtta ccacgcgcat tgtcaagcgc atgaacatac aagacctttg
     2521 gtccaagcca caggtggaag atacagagga gactgctagc aaggatgggt gcccaaaacc
     2581 caaggatgat gacgagttcg ttgtttcatc cgatgacatc aaaactgagg gcaagaaagg
     2641 aaagaacaaa tctggccgtg gtaagaagca cacagcattc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca aaagaatcag agaagaaaga aacggcaagt actctataga
     2761 ggagtacctt caggacagag acaagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaagaag aagaggccaa gatccggcaa aggattttta ggccaacaag
     2881 gaaacaacgc aaagaggaga gggcctctct cggtttggtc acaggttctg aaatcaggaa
     2941 gagaaaccca gacgacttca agcctaaagg aaagctgtgg gctgatgacg acaggagtgt
     3001 tgactacaat gagaaactta gttttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggtt tttgggtttc ccccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agttcttcgg ggttcccatc aagcaaattc agatacacaa
     3181 atcgggtgaa ttttgtcgct tgaggtttcc aaaaccaatc agaactgatg tgacaggcat
     3241 gatccttgaa gaaggtgcgc ccgaagggac cgtggtcaca ttactcatca agagaccaac
     3301 tggagaactc atgcccttgg cagccagaat ggggacccat gcaaccatga agatacaagg
     3361 gcgcactgtt gggggtcaaa tgggcatgct cctaacagga tctaacgcca agagtatgga
     3421 cctgggcacc acaccaggtg actgtggctg tccctacatt tacaagaggg ggaatgacta
     3481 catagtcatt ggagtccaca cggctgctgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggagt gagggagaag ccacacttga aggcggtgac aacaagggaa cctattgcgg
     3601 tgcacccatc ttaggtccag ggagtgcccc aaagctcagc accaagacta agttttggag
     3661 gtcatccaca gcaccactcc cacctggcac ctacgaacca gcctaccttg gcggcaagga
     3721 ccccagagtc aagggtggcc cctcattgca acaagtcatg agggaccagc tgaaaccatt
     3781 cactgagccc aggggtaaac caccaaaacc aagtgtgcta gaggctgcca agaaaaccat
     3841 catcaatgtt cttgaacaaa caattgatcc acctcaaaaa tggtcattcg cgcaggcatg
     3901 cgcatccctc gacaagacca cttccagtgg ccacccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaaatt ggcagaccag gcttccaagg ctaacctgat
     4021 gtttgaggag ggaaagaaca tgaccccagt ctacacaggt gcgcttaagg acgagctggt
     4081 caagactgac aaaatttatg gcaagatcaa aaagaggctc ctctggggct cggatctggc
     4141 gaccatgatc cggtgtgccc gagcgtttgg aggcctgatg gaggaactca aagcacattg
     4201 tgtcacacta cccgtcagag taggtatgaa tatgaatgag gatggcccta tcatctttga
     4261 gagacactcc agatataaat atcattatga tgctgattac tcccggtggg actcaacaca
     4321 acaaagagcc gtgttagcag cagccctaga aatcatggtc aagttctccc cagaaccgaa
     4381 tctggcccaa aaggttgcag aagaccttct ctctcccagc gtgatggacg ttggcgactt
     4441 caaaatatca atcaatgagg gcctcccctc cggggtgccc tgcacctctc aatggaattc
     4501 tatcgcccac tggctcctca ccctctgtgc gctttctgag gttacaaacc tgtcccctga
     4561 cattatccag gctaattccc tcttttcctt ctacggtgat gatgaaattg tgagcacaga
     4621 cataaaactg gacccagaga agctgacagc aaaacttaag gaatacgggt tgaaaccgac
     4681 tcgccctgac aagactgagg gaccccttgt tatctctgag gacctggatg gcctaacctt
     4741 cctgcggagg actgtgaccc gcgacccagc tggctggttt ggaaagctgg aacagagttc
     4801 aatacttagg caaatgtatt ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtctttg ctgggcgagg ctgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gctggtcatt gcagagctga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc tatgttcaga tggatgaggt tttcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctagt gatggtgcag ccggcctcgt gccagaaagt aacaatgagg
     5161 ttatggctct tgaacctgtt gctggggcat ctttagctgc ccctgtgact ggtcaaacta
     5221 atataattga cccatggatc agaatgaatt ttgttcaagc cccaaatgga gaattcactg
     5281 tttccccaag aaattcccct ggagaagtac tcctaaattt ggaattgggt cctgaattaa
     5341 acccttatct ggcacaccta tctaggatgt ataatggcta tgctgggggt atggaagtac
     5401 agatcatgct agctgggaat gcgttcactg ctggtaaact gatctttgct gctgtgcccc
     5461 cacattttcc cattgaaaat ttgagtcccc cccagattac aatgtttcca catgtgatta
     5521 tagatgttag aaccttagaa cctgtgttgc tccctatgcc tgacatcagg aattctttct
     5581 ttcactttat tcagagggat gagccaaaga tgaggttggt ggcaatgctg tacacgccac
     5641 tgaggtccaa cggatctggg gatgatgtat tcacagtctc ctgcagggtt ctgacccgcc
     5701 ccactcctga ttttgatttc acttacttag taccaccaac tgtcgagtca aagagtaagc
     5761 ctttcacttt acctatatta acattgggag agttgacaaa ttctaggttt ccattaccca
     5821 ttgatgtcct gtatactaac ccaaatgaga gtgcaattgt tcaatgtcag aatggtaggt
     5881 gcaccctgga cggcgagttg caggggacga ctcaactcct acccacaggc atctgtgcgt
     5941 tcaggggcaa agtcactcaa caggtgcagg atgaacatcg gggcacacat tggaatatga
     6001 cagtaaccaa cttaaatggc accccgtttg acccaactga ggatgtccct gctccactgg
     6061 gcaccccgga tttctccggc caaatttatg gggtaattag tcagaggaat accaacacag
     6121 ttcccggtga aggaaacctc ccggccaaca gggctcatga ggcagtgatt gcaacctaca
     6181 gtcccaaatt cacacccaaa ttgggcaata ttcaattcag cacttgggaa actcaagatg
     6241 tgagctctgg acaacccacc aagttcaccc cagttggctt ggcctccgtg gatgctaact
     6301 ctcattttga ccaatggacc ctccccagct attctggtgc cctaactcta aatatgaact
     6361 tggccccatc tgttgcccca gttttccctg gagagtgtct tttgttcttt agatctttca
     6421 tcccattaaa agggggctat gggaaccctg ctattgattg cttgatgcca caggaatggg
     6481 tccagcatct ctaccaggag tcggcaccat cccttagtga tgtggcttta gtgaggtatg
     6541 tgaacccaga aactgggcgc accctttttg aagccaagtt gcacaggaat ggatttctga
     6601 ctgttgctag gaacagtgct ggacctgtcg tggcccccac aaatggttat tttagatttg
     6661 attcttgggt caaccaattt tacactttag cccccatggg aaatggcagt gggcgcagaa
     6721 gaatgcagta atggctggag ctttcatagc aggtttggct ggtgacgttc tcagtaatgg
     6781 gatcgggtcg ctcattaatg ctggtgccaa tgcaatcaat cagaaagctg aattcgattt
     6841 caatagacaa ttacaacaaa actctttcaa tcatgataaa gaaatgctcc aggcccagat
     6901 tcaagcaaca aagcagctgc aggcagacat gatcgccatc aagcaagggg tgttgaccgc
     6961 tggcggcttc tcccccactg acgcagcaag aggagcagtc aacgctccca tgacacaggc
     7021 tttggactgg agtggcacga ggtactgggc cccaggtgcc atgagaacat ctagttattc
     7081 aggtaggttt ctgtcaacta ctccaactag gcaggttgag ttccctcagc gcaagagtgc
     7141 tgccccctct agtgctgatt ccacctatag tgggtcttct aggtctacag tttctactac
     7201 tctcggatct tctgcttctt ctagttctag aatatcaccc tcaactcatt ctagtttgat
     7261 ttctggcact tcttcctcaa gatcaagaac cagtgactgg gtgcgtgagc aaaaccgaag
     7321 tctagaaccc tttatgcatg gggctttgca gactgcttat gtcactcctc catcaagcag
     7381 agcttctagc aacgggacag tctcgaccgt cccaaaaggt gttttggact cttggacacc
     7441 tgcgtttaac acccgcaggc agccgctttt cgcatacctt cgaccgaagg gagagtcacg
     7501 agtttagtga aaagattaat tttctcttaa atttttcttt t
//