Typing tool

Complete norovirus genomes

AY134748  GII.2
 GII.P30

Length: 7,537 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7492
LOCUS       AY134748                7537 bp    RNA     linear   VRL 01-JUL-2004
DEFINITION  Snow Mountain virus, complete genome.
ACCESSION   AY134748
VERSION     AY134748.1
KEYWORDS    .
SOURCE      Snow Mountain virus
  ORGANISM  Snow Mountain virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7537)
  AUTHORS   Lochridge,V.P. and Hardy,M.E.
  TITLE     Snow Mountain virus genome sequence and virus-like particle
            assembly
  JOURNAL   Virus Genes 26 (1), 71-82 (2003)
   PUBMED   12680695
REFERENCE   2  (bases 1 to 7537)
  AUTHORS   Lochridge,V.P. and Hardy,M.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JUL-2002) Veterinary Molecular Biology, Montana State
            University, P.O. Box 173610, Bozeman, MT 59717, USA
FEATURES             Location/Qualifiers
     source          1..7537
                     /organism="Snow Mountain virus"
                     /mol_type="genomic RNA"
                     /host="Homo sapiens"
                     /db_xref="taxon:52276"
                     /note="genogroup 2;
                     serogroup: 3"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /note="SMV nonstructural proteins"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AAN08111.1"
                     /translation="MKMASNDASAAAAVNSNNDNAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEPVVHYSAKDGITGLPELTTVRQPE
                     EAATAFSVPPLDQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLYWRPVYTPQYLIAPDTLRKLHGELFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANILLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRTCKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRAIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRLRPVVVMISGKPGIGKTHLAREL
                     AKKIAITLSGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPVHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDVEK
                     AKRDFPGQPDMWKSAYSPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPNLTTFNFDRNKIQAFRQLAAENKYGLVDTMRVGGQLKGVRTI
                     PELKQALKNILIKRCQIVYGGSTYTLESDGKGNVKVEKVQNTNIQINNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQNLWSRPPVGDAEEVTSQDGC
                     PKPKDDEEFVISSSDITPEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDERVVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGTQEFFGVPIKQIQIHKSGEFCRLRFPKSIRTAVTGMILEEGAPEG
                     TVVSLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTVPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSFSQACASLDKTTSSGHPHHIRKNDCW
                     NGESFTGKLADQASKANLMYEEGKNMTPVYTGALKDELVKTDKIYGQIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRFSYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLAPSVMDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLAPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQIYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPTFYTKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="major capsid protein; VP1"
                     /codon_start=1
                     /product="viral protein 1"
                     /protein_id="AAN08112.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNNEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLQDNDHLYNITITNLNGSPFDPSEDIPAPLGVPDFQGRVFG
                     VITQRDKQNAAGQSQPANRGHDAVVPTYTAQYTPKLGQVQIGTWQTDDLKVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYLPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRIQ"
     gene            6713..7492
                     /gene="ORF3"
     CDS             6713..7492
                     /gene="ORF3"
                     /note="minor structural protein; VP2"
                     /codon_start=1
                     /product="viral protein 2"
                     /protein_id="AAN08113.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPTDAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGRFTSTAPARQADLQHTQNRPSSGSSVSSYATQSSRPTLTTTT
                     GSSHSTTSSNSTRSTNLSQSTVSRAASRTSEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESQA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgtcaaca gcaacaacga
       61 caacgcaaaa tcttcaagtg acggagtact atctagtatg gctgtcactt ttaaacgagc
      121 ccttggggcc cggcctaaac agccgccccc gagggaaata ccacaaaggc ccccaaggcc
      181 acccacccca gaactggtga aaaagatccc acctcccccg cccaacggag aagacgaacc
      241 ggtcgttcat tatagtgcta aagatggcat aactgggctg cccgaactta caacagtgag
      301 gcagccagaa gaggccgcta cagcattcag cgtcccaccc ctcgaccaga gagagaatag
      361 ggacgctaaa gagccattga ccggcaccat cttggagatg tgggatggcg agatttacca
      421 ttatggccta tatgtggagc gagggctggt gcttggcgtg cacaaaccac cagccgccat
      481 cagcctcgct aaagttgagt taacacctct atctttgtat tggagaccag tgtacacccc
      541 ccagtacctc atcgctcctg acaccctcag gaaactgcac ggggagttat ttccatacac
      601 ggcctttgat aacaactgct atgccttctg ctgctgggtg ttggacttaa acgattcttg
      661 gttgagcaga aggatgatac agagaacaac tggctttttc aggccttacc aagattggaa
      721 taggaagccc ctccccacca tggatgactc caagttgaag aaggtggcca acatactttt
      781 gtgtgccttg tcatcactat tcactagacc catcaaggac ataattggga aactcaggcc
      841 tctcaatatc cttaacatcc tggcttcttg tgattggact ttcgcaggta tagtggaatc
      901 tctaattctc ctagctgaac tcttcggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactgggtg actacgagct gcaaggaccc gaagatcttg ctgtggaact
     1021 tgtaccgata gtaatggggg ggataggatt ggtgttgggg ttcaccaagg aaaagattgg
     1081 gaagatgctg tcatctgccg cttccaccct gaggacctgc aaagaccttg gcgcctatgg
     1141 gctggaaatt ctgaaactgg tcatgaaatg gtttttccca aagaaagaag aggcaaacga
     1201 gcttgcgatg gtgagggcta ttgaggacgc agtcctagat ctcgaggcta ttgagaacaa
     1261 ccatatgaca gctctactca aagacaaaga tagcctcgcg acatacatga ggactcttga
     1321 tttggaggaa gaaaaggcca gaaagctctc cactaagtcc gcttcacctg atatagtggg
     1381 cacgatcaac gccctgctgg ctagaattgc cgctgctcgt tcccttgtac acagggccaa
     1441 ggaagaactg tccagcaggc taaggccagt tgttgtgatg atatctggca aacctggcat
     1501 cgggaagacc catctggcta gagaattggc aaagaagatc gctataaccc tttcaggaga
     1561 ccagagggta ggcctcatcc cccgcaacgg agtcgaccac tgggatgctt acaagggtga
     1621 gagagtcgtt ctctgggacg attatgggat gagtaacccc gtccatgatg ccctaagact
     1681 ccaagaactt gctgacacct gccctttgac cctaaactgt gacagaattg agaacaaggg
     1741 caaggtcttt gacagtgatg ccataatcat cacaaccaac ctggctaacc cagctccact
     1801 tgattatgtc aactttgaag cttgctccag gcgcattgac ttccttgtgt atgccgatgc
     1861 acctgacgtt gagaaagcga agcgcgactt cccgggacaa cctgacatgt ggaagagcgc
     1921 ttatagtccc gacttctcac acatcaagct aatgctggct ccccagggtg gttttgacaa
     1981 aaatggcaac accccacacg ggaaaggtgt catgaagacc ctcacaacag gctccctcat
     2041 tgcccgtgct tcagggctcc tccatgaacg attggatgaa ttcgaactac aaggacccaa
     2101 cctcacaact ttcaactttg accgtaataa aatacaggct tttaggcagc ttgccgctga
     2161 aaacaaatat ggcctggtgg acacaatgag agtgggtgga caactcaagg gtgtcagaac
     2221 tataccagaa ctcaagcagg ccctcaagaa catattaatc aaaaggtgcc agatagtgta
     2281 tggtggcagc acctatacac ttgaatctga tggcaaaggg aatgtgaaag tggaaaaagt
     2341 gcaaaatacc aacatccaaa tcaacaacga gctagctggt gctttacacc acctccgatg
     2401 cgctaggatc aggtactatg ttaaatgtgt tcaggaggct ctatattcca tcatccaaat
     2461 tgctggggcc gcgtttgtaa ccacgcgcat tgtgaagcgc atgaacatac aaaacttgtg
     2521 gtcaaggcct ccagtaggag atgcggagga ggtcactagc caggatggtt gcccaaagcc
     2581 caaagatgat gaggagttcg tcatctcgtc tagtgacatc acgcctgaag gcaagaaagg
     2641 aaagaacaag actggccgcg gcaagaaaca cacagccttc tcgagcaagg gtctcagtga
     2701 tgaggagtac gatgagtaca aaagaatcag ggaagaaagg aatggtaagt actccataga
     2761 agaatacctt caggacagag acaagtatta tgaggaagtg gccatagcca gggcaactga
     2821 ggaagacttc tgtgaggaag aagaagccaa gatccgacag aggatattta ggccaacgag
     2881 gaagcaacgc aaggaggaga gggcttccct tggccttgtc actggctcag agatcagaaa
     2941 gagaaaccca gacgacttca aacctaaagg aaagctgtgg gctgatgatg aaagggtcgt
     3001 tgactataat gagaaactca gttttgaggc ccccccgagc atctggtcaa ggatagtcaa
     3061 ctttgggtca ggatgggggt tctgggtgtc ccctagcctg tttattacat caacccatgt
     3121 tataccccaa ggcactcagg aattctttgg tgtacccatc aagcagattc agattcacaa
     3181 atcaggggag ttctgccgcc tgagattccc taaatcaatc agaactgctg taacaggcat
     3241 gatcctagaa gagggggccc cagaaggaac cgtggtctca ctactcatca agagaccaac
     3301 cggtgagctc atgcccctgg cagccagaat gggcacccat gcgactatga aaatccaagg
     3361 tcgcacggtt ggaggtcaga tgggtatgtt gctaacaggg tccaatgcta aaagcatgga
     3421 tttgggcacg acacctggtg actgtggctg cccctatatt tataagagag gcaatgacta
     3481 cgtggtcatc ggcgtgcaca cagccgctgc tcgcggaggt aacactgtca tctgtgcaac
     3541 ccagggcagt gaaggtgagg ccacgctcga aggcggtgat aacaaaggca cctactgtgg
     3601 agctccaata ctaggccctg gtaacgctcc caagctcagc accaagacta aattctggag
     3661 gtcctccaca gtgccactcc cacccgggac ctatgaacca gcttacttag gtggcaagga
     3721 ccccagggtg aagggtggac cttcactaca acaagtcatg agagaccagc taaaaccatt
     3781 cactgagcct aggggcaaac cacccaagcc aagtgtgctg gaagctgcca agaagaccat
     3841 tatcaatgtg ttggagcaaa caatagatcc cccccaaaaa tggtcatttt cacaagcatg
     3901 tgcgtcgctt gataaaacca cctccagcgg ccacccccac cacatacgga agaacgattg
     3961 ctggaatggg gagtctttta caggaaaatt ggcagatcaa gcatcaaaag ctaacctaat
     4021 gtatgaggaa ggaaagaaca tgaccccagt ctacacaggg gccctcaagg atgagctggt
     4081 caagactgac aagatctatg ggcagatcaa gaaaaggctt ctttggggct ctgacttggc
     4141 aacaatgatc cgttgtgcgc gggcgtttgg agggttaatg gatgagctca aggcccattg
     4201 cgtaacactc cctgtcaggg ttgggatgaa catgaatgag gatggaccca taatttttga
     4261 aaagcactcc aggttctcat accactatga tgcagattac tcacgctggg actcaaccca
     4321 acagagggca gtgctagctg cagccttgga aatcatggta aaattctcac cagaaccaca
     4381 tttggcccaa attgttgcag aggatctcct agcccccagt gtgatggatg taggtgattt
     4441 caaaataaca attaatgagg gactgccctc gggagtaccc tgcacatcac agtggaattc
     4501 catcgcccac tggctcctca cactctgcgc actatctgaa gtcacaaacc tggctcctga
     4561 catcatacaa gctaactcct tgttctcttt ctatggtgat gatgaaatcg taagtactga
     4621 cataaaatta gacccagaga aactcacagc aaaactcaaa gaatacggac tcaaaccaac
     4681 ccgcccggac aaaactgaag gacccctgat catatccgag gacttgaatg gtttgacctt
     4741 tctgcggcgg accgtgaccc gtgatccagc tgggtggttt ggcaagttgg accagagttc
     4801 aattctcagg cagatatact ggactagggg ccccaaccat gaggacccgt ccgaaacaat
     4861 gataccacac tcccagaggc ctatacagct gatgtctctt ttgggtgaag cagccttgca
     4921 tggtccaaca ttttacacca aaatcagtaa actggtcatc acagagctga aggaaggtgg
     4981 catggatttt tacgtgccca gacaggaacc catgttcagg tggatgagat tctcagattt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatctact gatggtgcag ccggcctcgt gccagaaagt aataatgagg
     5161 tcatggctct tgagcccgtg gctggtgctg ccttggcagc cccggtcacc ggtcaaacaa
     5221 atattataga cccttggatt agagcaaatt ttgtccaggc ccctaatggt gaatttacag
     5281 tttctccccg taatgcccct ggtgaagtgc tattaaatct agaattgggt ccagaattaa
     5341 atccttatct ggcacattta gcaagaatgt acaacgggta tgccggtggg atggaggtgc
     5401 aggtcatgct agctgggaac gcgttcacag ctggcaaatt ggtcttcgct gctgtaccac
     5461 ctcatttccc ggttgaaaac cttagtccac agcaaattac catgttccct catgtgatta
     5521 tagatgttag gactttggaa cctgttttat tgccactccc cgatgttaga aataatttct
     5581 tccattataa tcaaaaagat gatcctaaga tgagaattgt ggctatgctt tatactcccc
     5641 tcaggtccaa tggttctggt gatgatgtgt tcacagtctc ttgcagggtg ttgactagac
     5701 cctcccctga ttttgatttt acatacctgg taccaccaac agtggaatcc aaaacaaaac
     5761 cattcaccct tccaattctt acacttgggg agctttccaa ttctagattt ccagtgtcca
     5821 tagatcagat gtacactagc cccaatgaag tcatatctgt gcagtgccag aatggaaggt
     5881 gcacactgga tggggagctc caaggaacaa cacagctcca agttagtggc atttgtgcat
     5941 tcaaaggaga agtgaccgct cacttgcagg acaatgatca cctatacaac atcaccatca
     6001 caaacttgaa tgggtcccct tttgatccct ctgaggacat ccccgccccc ctgggtgtgc
     6061 ccgactttca gggaagagtc tttggtgtca tcactcaaag agacaaacag aatgccgctg
     6121 ggcaaagcca gccggcaaac aggggacacg atgctgtggt ccccacttac acagcccagt
     6181 ataccccaaa attgggtcag gttcaaattg gcacatggca gaccgacgat cttaaagtca
     6241 accaaccagt caaattcacc ccagtcggtc tcaatgacac agaacatttc aatcagtggg
     6301 tggtccctag gtacgctggt gctttaaatc taaacacaaa tcttgccccc tctgttgctc
     6361 cagtgtttcc aggggagcgt ctgctcttct ttagatcata cctccccctt aagggtggtt
     6421 atggaaaccc agctattgat tgcctgctac cacaagagtg ggtgcagcat ttttatcagg
     6481 aagcagcccc ctcaatgagt gaggtagccc ttgtcagata catcaatccg gacactggcc
     6541 gggcgctgtt tgaggccaaa ctccacagag ctggtttcat gacagtctcg agtaacacca
     6601 gtgctccggt ggttgtgcct gccaacggat acttcagatt tgactcttgg gtgaaccaat
     6661 tttattctct tgcccccatg ggaactggaa atgggcgtag aaggattcag tgatggctgg
     6721 agcttttgta gctggtctcg cgggggatgt gctcagcaat gggctcagct cactaattaa
     6781 tgcaggtgct aatgcaataa atcagagagc agaatttgat tttaatcaga aattacagca
     6841 aaattctttt aatcatgata aggagatgtt gcaggctcag attcaggcaa ctaagcagct
     6901 gcaggcagac atgatggcta taaagcaggg ggttctgacc gctggcggct tttcccctac
     6961 tgatgcagcc agaggcgctg tgaacgcgcc catgacacag gcgctggatt ggaatggcac
     7021 aaggtattgg gcaccaggct ccatgaggac tacatcctac tctgggaggt tcacatcgac
     7081 cgccccggca aggcaggccg atcttcaaca cactcaaaat cggccttcga gtggctcttc
     7141 tgtgtcctct tatgccactc aatcttcaag accaactcta accacaacca cagggtcctc
     7201 acatagtaca acctcatcca attcgacccg tagcacaaac ctttcccagt cgacggtctc
     7261 tagggctgca tccaggacta gtgagtgggt tagagatcaa aatagaaatt tggaacccta
     7321 catgcatggt gccttacaga cagcctttgt caccccacct tccagcaggg catctgacgg
     7381 gacagtctca accgtcccca aaggtgtttt ggactcctgg acacctgcgt tcaacacccg
     7441 caggcagccg ctttttgcac acctccgtaa gaggggggag tcacaagctt agtgaaaagg
     7501 tgaaaaattt actttaaatg aattgattct acctttt
//