Typing tool

Complete norovirus genomes

AY032605  GII.4 Sydney
 GII.P12

Length: 7,556 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       AY032605                7556 bp ss-RNA     linear   VRL 29-JAN-2002
DEFINITION  Human calicivirus Hu/NLV/GII/MD145-12/1987/US, complete genome.
ACCESSION   AY032605
VERSION     AY032605.1
KEYWORDS    .
SOURCE      Human calicivirus Hu/NLV/GII/MD145-12/1987/US
  ORGANISM  Human calicivirus Hu/NLV/GII/MD145-12/1987/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7556)
  AUTHORS   Green,K.Y., Belliot,G., Taylor,J.L., Valdesuso,J., Lew,J.F.,
            Kapikian,A.Z. and Lin,F.Y.
  TITLE     A predominant role for Norwalk-like viruses as agents of epidemic
            gastroenteritis in Maryland nursing homes for the elderly
  JOURNAL   J. Infect. Dis. 185 (2), 133-146 (2002)
   PUBMED   11807686
REFERENCE   2  (bases 1 to 7556)
  AUTHORS   Belliot,G.M. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-APR-2001) NIAID/LID/Epidemiology, NIH, 9000 Rockville
            Pike, Bethesda, MD 20892, USA
FEATURES             Location/Qualifiers
     source          1..7556
                     /organism="Human calicivirus Hu/NLV/GII/MD145-12/1987/US"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:158465"
     CDS             5..5104
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AAK50354.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAITFKRALGARP
                     KQPPPREILQRPPRPPTPELVKKIPPPPPNGEDELVVSYSVKDGVSGLPELSTVRQPD
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRTIQRTTGFFRPYQDWNRKPLPTVDDSKLKKVANLFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILMAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTSLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKRCQIVYSGCTYTLESDGKGSVKVDRVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETINKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMVLGTTPGD
                     CGCPYIYKRENDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSFTQACASLDKTTSSGHPHHIRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLTISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6704
                     /note="major structural protein"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AAK50355.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNIIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSHDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTHIVGSHDYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDG
                     DHHQNEPQQWVLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVLHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6704..7510
                     /note="minor structural protein"
                     /codon_start=1
                     /product="ORF3 protein"
                     /protein_id="AAK50356.1"
                     /translation="MAGSFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATQKLQQDLMKVKQAVLLEGGFSTTDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTLQPSGALPGRTNPRITVPARGPPSTLS
                     NASTATSVYSNQTVSTRLGSSAGSGTGVSSLPSTARTRNWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSNQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctatcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ctacaaagac ccccacgacc
      181 acctacccca gaactggtca aaaagatccc ccctcccccg cccaacgggg aggatgaact
      241 agtggtttct tatagtgtca aagatggcgt ttccggtctg cctgagcttt ccactgtcag
      301 gcaaccggat gaagccaata cggccttcag tgttccccca ctcaatcaga gggagaatag
      361 ggatgccaag gagccactaa ctggaacaat tctggaaatg tgggatggag agatctacca
      421 ttacggccta tatgtggagc gaggtcttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tatacactcc
      541 ccagtatctc atctccccag acactctcaa gagattgcac ggagaatcgt tcccctatac
      601 agccttcgac aacaattgct atgccttctg ttgctgggtc ttagacctaa acgactcgtg
      661 gctgagtagg agaacgatcc agagaacaac tggtttcttt agaccctatc aagactggaa
      721 taggaaaccc ctccctactg tggatgactc caaattaaag aaggtagcta acttattcct
      781 gtgtgctcta tcttcactat tcaccaggcc catcaaagac ataataggga aactaagacc
      841 tctcaacatc ctcaacatct tggcctcatg tgattggact ttcgcaggca tagtggaatc
      901 cttgatactc atggcagagc tctttggagt tttctggacg cccccagatg tgtctgcgat
      961 gattgccccc ttgctaggtg attacgagtt acaagggcct gaggaccttg cagtggaact
     1021 cgttcctata gtgatggggg gaattggttt ggtgctagga tttaccaaag agaagattgg
     1081 gaagatgttg tcatctgctg catccacctt aagagcttgt aaagatcttg gtgcatacgg
     1141 gctggaaatc ctaaaattag tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgagatcca tcgaggatgc ggtgctggac ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc agcctgctca aagacaaaga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaagctctc aaccaagtct gcttcacctg atatcgtggg
     1381 tacaatcaac gcccttctgg caagaatcgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac caagacccgt tgtcgtgatg atatcaggca gaccagggat
     1501 agggaagacc caccttgcca gggaactggc caagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggtctcatcc cacgcaatgg cgtcgaccac tgggacgcat acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagtaatccc atccatgatg ccctcaggtt
     1681 acaagaactc gctgacactt gccccctcac tctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaat ctggccaacc cagcaccact
     1801 ggactacgtc aactttgagg catgctcgag gcgcatcgat ttcctcgtgt atgcagatgc
     1861 ccctgaagtc gagaaggcga aacgtgattt tccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gatttctcgc acataaaact aacgctggct ccacagggtg gcttcgacaa
     1981 gaatggaaac accccacatg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcagggctac tccatgagag gttagatgag tatgagctac agggcccaac
     2101 tctcaccact ttcaactttg atcgcaacaa ggtgcttgct tttaggcagc ttgctgctga
     2161 aaacaaatac gggctgatgg acacaatgaa agttggaaga cagctcaagg atgtcagaac
     2221 catgccagag cttaaacaag cactcaagaa tatctcaatc aagaggtgcc agatagtgta
     2281 cagtggttgc acctatacac ttgagtctga tggcaagggc agtgtgaaag ttgacagagt
     2341 tcagagcgcc accgtgcaga ccaataacga gctggccggc gccctacacc atctaaggtg
     2401 cgccagaatt aggtactatg tcaagtgtgt ccaggaggcc ctatattcca tcatccaaat
     2461 tgctggagct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctctg
     2521 gtccaagcca caagtggaag acacagagga gactatcaac aaggacgggt gcccaaaacc
     2581 caaagatgat gaggagttcg tcgtctcatc tgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca agagaatcag agaagaaaga aacggcaagt actccataga
     2761 agagtacctt caggacaggg acaagtacta tgaggaggtg gccattgcca gggcgaccga
     2821 agaggacttc tgtgaagagg aggaggccaa gattcggcag aggattttca ggccaacaag
     2881 gaaacaacgc aaggaggaga gggcctctct cggtttagtc acaggctctg aaatcaggaa
     2941 gaggaaccca gatgatttca agcccaaggg aaaactgtgg gctgatgatg acaggagtgt
     3001 agactacaat gagagactca gttttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtttc tcccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agttctttgg agtccccatc aagcaaattc agatacacaa
     3181 atcgggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggtac cgtggccacc ctactcatca agaggcctac
     3301 tggagaactt atgcccttag cagccagaat ggggacccat gcaaccatga aaattcaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaacgcca aaagcatggt
     3421 tctaggcacc acaccaggtg actgcggctg cccctacatc tacaagaggg agaatgacta
     3481 cgtggttatt ggagtccaca cggctgccgc tcgtgggggg aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ctacacttga aggcggtgac agtaagggaa cctactgtgg
     3601 tgcaccaatc ctaggcccag gaagtgcccc aaaactcagc accaagacta aattctggag
     3661 atcatctaca acaccactcc cacctggcac ctatgaacca gcctaccttg gtggtaagga
     3721 ccccagagtc aagggtggcc cttcattgca acaagtcatg agggatcagc tgaaaccatt
     3781 tacagagccc aggggcaaac caccaaagcc aagtgtgttg gaggctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgatcc acctcagaag tggtcattca cgcaagcttg
     3901 cgcgtccctc gacaagacta cttccagtgg ccatccgcac cacatacgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagtt ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaagag gggaagaaca tgaccccggt ctacacaggt gcgcttaagg atgagttggt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggacttagc
     4141 gaccatgatc cggtgcgctc gggcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgttacactt cctgtcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcattcc aggtataaat atcactatga tgctgattac tctcggtggg attcaacgca
     4321 acagagagcc gtattagcag cagccctaga aatcatggtt aaattctccc cagaaccaca
     4381 tctggcccag atagttgcag aagaccttct ctctcctagt gtgatggatg tgggtgactt
     4441 caaaatatca atcaatgagg gtctcccctc tggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctctgtgc actctctgaa gtcacaaacc tgtcccctga
     4561 tatcatacag gctaattccc tcttctcctt ttatggcgat gatgaaattg tcagtacaga
     4621 tataaagttg gacccagaga aattgacagc aaaactcaag gaatacgggt tgaaaccaac
     4681 ccgccctgac aaaactgaag gaccccttac tatctctgaa gacttgaatg gtctgacctt
     4741 cctgcggaga actgtgaccc gcgacccagc tggctggttt ggaaaattgg aacagagttc
     4801 aatacttagg caaatgtact ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt aatgtcccta ctgggcgagg ccgcactcca
     4921 cggcccagca ttctacagca aaattagcaa gctagtcatt gcagagctga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atataattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tgtcccctag aaacgctcca ggtgagatac tatggagcgc gcccttgggc cctgatttga
     5341 acccctatct ttctcatttg tccagaatgt acaatggtta tgcaggcggt ttcgaagtgc
     5401 aagtaatcct cgcggggaac gcgttcaccg ccgggaaagt tatatttgca gcagttccac
     5461 caaactttcc aactgaaggc ttaagcccca gccaggttac tatgttcccc catataattg
     5521 tagatgttag gcaattggaa cctgtgttga tccccctacc tgatgttagg aataatttct
     5581 atcattacaa tcaatcacat gattctaccc ttaagttgat agcaatgttg tatacaccac
     5641 tcagggctaa taatgccggg gacgatgtct tcacagtctc ttgtcgagtt ctcacgaggc
     5701 catcccccga ttttgatttc atattcttgg tgccacccac agttgaatca agaactaaac
     5761 cattcaccgt cccaatctta actgttgagg aaatgtccaa ttcaagattc cccattcctt
     5821 tggaaaagtt gtacacgggt cctagcagtg cttttgttgt ccaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggtacta cccagctgtc agctgtcaac atctgtaact
     5941 ttagggggga tgtcacccat attgtgggca gccatgatta tacaatgaat ctggcttccc
     6001 aaaattggag caattatgac ccaacagaag aaatcccagc ccccctggga acaccagatt
     6061 ttgtggggaa gatccaaggc ctgctcaccc agaccacaag agcggatggc tcgacccgtg
     6121 cccacaaagc tacagtgagc actgggagtg tccacttcac tccaaagctg ggtagtgttc
     6181 aattcaccac tgacacaaac aatgatttcc aaactggcca aaacacgaaa ttcaccccag
     6241 ttggcgtcat ccaggacggt gatcaccatc agaatgagcc ccaacaatgg gtactcccaa
     6301 attactcagg tagaactggt cataatgtgc acctggcccc tgccgttgcc cccacttttc
     6361 cgggtgagca actccttttc tttagatcca ctatgcccgg atgtagcggg tatcccaaca
     6421 tgaatttgga ttgcctactc ccccaggaat gggtgctgca cttctaccag gaagcagctc
     6481 cagcacaatc cgatgtggct ctgctgagat ttgtgaatcc agacacaggt agggttctgt
     6541 ttgagtgcaa gctccataaa tcaggctata tcacagtggc tcacaccggc ccgtatgact
     6601 tggttatccc ccccaatggt tattttagat ttgattcctg ggtcaaccag ttctacacac
     6661 ttgcccccat gggaaatgga acggggcgca ggcgtgcatt ataatggctg gatctttctt
     6721 tgctggattg gcatctgatg tcctcggctc tggacttggt tctctaatca atgctggagc
     6781 tggggccatc aaccaaaaag ttgaatttga aaataacaga aaattgcaac aagcttcctt
     6841 ccaatttagt agcaatctac aacaggcttc cttccaacat gataaagaga tgctccaagc
     6901 acaaattgag gctactcaaa aattgcaaca ggatctgatg aaggttaaac aggcagtgct
     6961 cctagagggt ggattttcca caacagatgc agcccgtggg gcaatcaacg cccccatgac
     7021 aaaggctctg gactggagcg gaacaaggta ctgggcccct gatgccagga ccacaacata
     7081 caatgcaggc cgcttttcca cccttcagcc ttcgggggca ctgccaggaa gaactaatcc
     7141 taggattacc gtccccgctc ggggcccccc cagcacactt tctaatgctt ctactgctac
     7201 ttctgtgtat tcaaatcaaa ctgtttcaac gagactaggt tcttcagctg gttctggtac
     7261 cggtgtctcg agtctcccgt caactgcaag gactaggaac tgggttgagg accaaaacag
     7321 gaatttgtca cctttcatga ggggggctct caacacatca ttcgtcaccc ctccatctag
     7381 tagatcctct aaccaaggca cagtctcaac cgtgcctaaa gaaattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagcctct cttcgctcac attcgcaaac gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaaattgat tttctttctc ttctttagtg tctttt
//