Typing tool

Complete norovirus genomes

AF145896  GII.4 Sydney
 GII.P4 US95

Length: 7,555 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       AF145896                7555 bp    RNA     linear   VRL 19-NOV-1999
DEFINITION  Camberwell virus polyprotein and capsid genes, complete cds; and
            unknown gene.
ACCESSION   AF145896
VERSION     AF145896.1
KEYWORDS    .
SOURCE      Camberwell virus
  ORGANISM  Camberwell virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7555)
  AUTHORS   Seah,E.L., Marshall,J.A. and Wright,P.J.
  TITLE     Open reading frame 1 of the Norwalk-like virus Camberwell:
            completion of sequence and expression in mammalian cells
  JOURNAL   J. Virol. 73 (12), 10531-10535 (1999)
   PUBMED   10559373
REFERENCE   2  (bases 1 to 7555)
  AUTHORS   Seah,E.L., Marshall,J.A. and Wright,P.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-1999) Microbiology, Monash University, Wellington
            Road, Clayton, Victoria 3168, Australia
FEATURES             Location/Qualifiers
     source          1..7555
                     /organism="Camberwell virus"
                     /mol_type="genomic RNA"
                     /strain="Hu/NLV/Camberwell/101922/94/AUS"
                     /db_xref="taxon:94433"
                     /note="Human Calicivirus"
     CDS             5..5104
                     /note="non-structural proteins; ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AAD33960.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPLPREIPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSVKGGVSGLPELSTVRQPD
                     ETSTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNKKPLPTVDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTLTTFNFDRNKVIAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNILIKRCQIVYSGCTYTLESDGKGNVKVDRVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSRPQVEDTEETINKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERTSLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRENDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSFTQACASLDKTTSSGHPHHIRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVALPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6704
                     /note="58 kDa; ORF2"
                     /codon_start=1
                     /product="capsid"
                     /protein_id="AAD33961.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNIIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSHDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTHIVGSHDYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDG
                     DHHQNEPQQWVLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVLHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPFDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6704..7510
                     /note="encodes a small basic protein of unknown function;
                     ORF3"
                     /codon_start=1
                     /product="unknown"
                     /protein_id="AAD33962.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATQKLQQGLMKVKQAMLLEGGFSTTDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTSQPSGALPGRTTPRVTVPARGPPSTLS
                     NASTATSVYSNQTVSTRLGSSAGSGTGVSSFPSTVRTRNWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSNQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttccagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcctctccc gagggaaata ccgcaaagac ccccacggcc
      181 acctactcca gaactggtca aaaagatccc ccctccccca cccaacgggg aggatgaact
      241 agtggtttct tatagtgtca aaggtggcgt ttccggtctg cctgagcttt ccactgtcag
      301 gcaaccggat gaaactagca cggccttcag tgttccccca ctcaatcaga gggagaatag
      361 ggatgccaag gagccactaa ctggaacaat tctggaaatg tgggacggag agatctacca
      421 ttacggcctg tatgtggagc gaggtcttgt gctcggcgtg cacaaaccac cagctgccat
      481 tagtctcgcc aaggtcgaac tgacaccact ctccttgttc tggagacctg tatacactcc
      541 ccagtatctc atttccccag acactctcaa gaaattgcac ggagaatcgt tcccctatac
      601 agcctttgac aacaattgct atgccttctg ttgttgggtc ttagacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agaggacaac tggtttcttc agaccctatc aagattggaa
      721 taagaaaccc ctccctactg tggatgactc caaattaaag aaggtagcta acatattcct
      781 gtgtgcccta tcttcactat tcaccaggcc catcaaagac ataataggga agctaagacc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggacc ttcgcaggcg tagtggaatc
      901 cttgatactc ttggctgagc tctttggagt cttttggaca cccccagatg tgtctgcgat
      961 gattgccccc ttgctaggtg attacgagtt acaaggacct gaggaccttg cagtggaact
     1021 cgttcctata gtgatggggg ggattggctt ggtgttagga tttaccaaag agaagattgg
     1081 gaagatgttg tcatctgctg catccacctt aagagcttgt aaagatcttg gtgcatacgg
     1141 actggaaatc ctaaagttag tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgagatcca tcgaggatgc ggtgctggac ctcgaggcga ttgaaaacaa
     1261 ccatatgacc accctgctca aggacaaaga cagcctggca acctatatga gaacccttga
     1321 cctggaggag gagaaagcca ggaaactctc aaccaagtct gcttcacctg atatcgtggg
     1381 tacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt tgtcgtgatg atatcaggca gaccagggat
     1501 agggaaaacc caccttgcca gggaactggc caagagaatc gcagcgtccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgaccac tgggacgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagtaatccc atccatgatg ccctcaggtt
     1681 acaagaactc gctgacacct gccccctcac tctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataattat caccactaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgagg catgctcgag gcgcatcgat ttcctcgtgt atgcagatgc
     1861 ccctgaagtc gagaaggcga agcgtgattt tccaggtcaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gatttttcgc acataaaact aacactggct ccacagggtg gcttcgataa
     1981 gaatgggaac accccacatg ggaagggcgt catgaagact ctcaccactg gttcccttat
     2041 tgcccgggca tcagggctac tccatgagag gttagatgag tatgagctac agggcccaac
     2101 actcaccacc tttaactttg atcgcaacaa ggtgattgct ttcaggcagc ttgctgctga
     2161 aaacaaatac gggttgatgg acacaatgaa agttggaaga cagctcaagg atgtcagaac
     2221 catgccagag ctcaagcaag cactcaagaa tatcttaatc aagaggtgcc agatagtgta
     2281 cagtggttgc acctatacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcgcc accgtgcaga ccaataacga gttggccgga gccctacacc atctaaggtg
     2401 cgccagaatt aggtactatg tcaagtgtgt ccaggaggcc ctatattcca ttatccaaat
     2461 tgctggagct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctctg
     2521 gtccaggcca caagtggaag acacagagga gactatcaac aaggacgggt gcccaaaacc
     2581 caaagatgat gaggagttcg tcgtctcatc cgacgacatc aaaaccgagg gcaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagcaaag gcctcagtga
     2701 tgaagagtac gacgagtaca agaggatcag agaagaaaga aacggcaagt actccataga
     2761 agaatacctc caggacaggg acaagtacta tgaggaggtg gccattgcca gggcaaccga
     2821 ggaggacttc tgtgaggagg aggaggccaa gatccggcag aggattttca ggccaacaag
     2881 gaaacaacgc aaggaggaaa ggacctctct cggtttggtc acaggctctg aaatcaggaa
     2941 gaggaaccca gatgacttca agcccaaggg aaaactgtgg gctgatgatg acaggagtgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagt atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tttgggtctc ccccagccta ttcataacat caacccacgt
     3121 tataccccag ggcgcacagg agttctttgg agtccccatc aagcaaattc agatacacaa
     3181 atcgggcgag ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggtac cgtggccaca ctactcatca agaggcctac
     3301 tggagagctt atgcccttag cagccagaat ggggacccat gcaaccatga aaattcaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacggga tccaacgcca aaagcatgga
     3421 tctaggtacc actccaggtg actgcggctg cccctacatc tacaagaggg aaaatgacta
     3481 cgtggttatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 tcaggggagt gagggagaag ctacacttga aggcggtgac aataagggaa cctactgtgg
     3601 cgcaccaatc ctaggtccag gaagtgcccc aaagctcagc accaagacta aattctggag
     3661 atcatccaca acaccactcc cacctggcac ctatgaacca gcttatcttg gtggtaagga
     3721 ccccagagtc aagggtggcc cttcattgca acaagttatg agggatcagc tgaaaccatt
     3781 tacagagccc aggggcaaac caccaaagcc aagtgtcttg gaggccgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgatcc gcctcagaag tggtcattca cgcaagcttg
     3901 cgcatccctc gacaagacta cttccagtgg ccatccgcac cacatacgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagtt ggcagaccag gcttccaaag ccaacctgat
     4021 gttcgaagag gggaagaaca tgaccccagt ttacacaggt gcgcttaagg atgagttggt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggacttagc
     4141 gaccatgatc cggtgcgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgttgcactt cctgtcagag ttggtatgaa catgaatgag gatggcccca tcatcttcga
     4261 gaggcattcc aggtacaaat atcactatga tgctgattac tctcgatggg attcgacaca
     4321 acagagagcc gtgttagcag cagccctaga aatcatggtt aaattctccc cagaaccaca
     4381 cctggcccag atagttgcag aagaccttct ttctcctagt gtgatggatg tgggtgactt
     4441 caaaatatca atcaatgagg gtctcccctc tggggtgccc tgtacctccc agtggaactc
     4501 catcgcccac tggctcctca ctctctgtgc actctctgaa gttacaaatt tgtcccctga
     4561 catcatacag gctaattccc tcttctcctt ctatggcgat gatgagattg tcagtacaga
     4621 tataaagttg gacccagaga aattgacagc aaaactcaag gaatacgggc taaaaccaac
     4681 ccgccctgac aaaactgaag gaccccttat tatttctgaa gacttgaatg gcctgacctt
     4741 cctgcggaga actgtgaccc gcgacccagc tggctggttt ggaaaattgg aacagagctc
     4801 aatacttagg caaatgtact ggactagggg ccccaaccat gaggacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt aatgtcccta ctgggagagg ccgcactcca
     4921 cggcccagca ttctacagca aaattagcaa gctagtcatt gcagagttga aggaaggtgg
     4981 catggacttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atataattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tgtcccctag aaacgctcca ggtgagatac tatggagcgc gcccttgggc cctgatttga
     5341 atccctatct ttctcacttg tccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aagtgatcct tgcggggaac gcgttcaccg ccgggaaagt tatatttgca gcagttccac
     5461 caaactttcc aactgaaggc ttaagcccca gccaggttac tatgttcccc catataattg
     5521 tagatgttag acaactggaa cctgtgttga ttcccctacc tgatgtcagg aataatttct
     5581 atcattacaa tcaatcacat gattctaccc ttaaattgat agcaatgctg tacacaccac
     5641 ttagggctaa taatgccggg gatgatgtct ttacagtctc ttgtcgagtt ctcacgagac
     5701 catcccccga ttttgatttt atattcttgg tgccacccac agttgaatca agaactaaac
     5761 cattcaccgt cccaatttta accgttgagg aaatgtccaa ttcaagattc cccattcctt
     5821 tggaaaagct gtatacgggt cccagcagtg cttttgttgt acaaccacaa aatggcagat
     5881 gcacgactga cggcgtgctc ttaggcacta cccagctgtc agctgtcaac atctgcaact
     5941 ttagggggga tgtcacccat attgtgggca gccatgatta tacaatgaac ttggcttccc
     6001 aaaattggag caattatgac ccaacagaag aaatcccagc ccccctggga acaccagatt
     6061 ttgtggggaa gatccaaggt ctgctcaccc aaaccacaag agcagatggc tcgacccgtg
     6121 cccacaaagc tacagtgagc actgggagtg tccacttcac tccaaagctg ggtagtgttc
     6181 aattcaccac tgacacaaac aatgatttcc aaactggcca aaacacgaaa ttcaccccag
     6241 ttggtgtcat ccaagacggt gaccaccacc agaatgagcc ccaacaatgg gtactcccga
     6301 attattcagg tagaactggt cataatgtgc acctggcccc tgccgttgcc cccacttttc
     6361 cgggtgagca actccttttc tttagatcca ctatgcccgg gtgtagcggg tatcccaaca
     6421 tgaacttgga ctgcctactc ccccaggaat gggtgctgca cttctaccag gaagcagctc
     6481 cagcacaatc tgatgtggct ctgctgagat ttgtgaatcc agacacaggt agggttctgt
     6541 ttgagtgcaa gctccataag tcaggctaca tcacagtggc ccacaccggc ccgtttgact
     6601 tggttatccc ccctaatggt tattttagat ttgattcttg ggtcaaccag ttctacacac
     6661 ttgcccccat gggaaatggg acggggcgca ggcgtgcatt ataatggctg gagctttctt
     6721 tgctggattg gcatctgatg tccttggctc tggacttggt tctctaatca atgctggggc
     6781 tggggccatc aaccaaaaag ttgaatttga aaataacaga aaattgcaac aagcttcctt
     6841 ccaatttagt agcaatctgc aacaggcttc cttccaacat gataaagaga tgctccaagc
     6901 acaaattgag gctacccaaa aattgcaaca gggtctgatg aaggttaaac aggcaatgct
     6961 cctagagggt ggattctcca caacagatgc agcccgtggg gcaatcaacg cccccatgac
     7021 aaaggctctg gactggagcg gaacaaggta ctgggcccct gatgccagga ccacaacata
     7081 caatgcaggc cgcttttcca cctctcagcc ttcgggggca ttgccaggaa gaactactcc
     7141 tagggttacc gtccccgctc ggggtccccc tagcacactt tccaatgctt ctactgctac
     7201 ttctgtatat tcaaatcaaa ctgtttcaac gagactaggt tcttcagctg gttctggcac
     7261 cggtgtctcg agtttcccgt caactgtaag gactaggaac tgggttgagg accaaaacag
     7321 aaatctgtca cctttcatga ggggggctct caatacatca ttcgtcaccc caccatctag
     7381 tagatcctcc aaccaaggca cagtctcaac cgtgcctaaa gaaattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagcctct ctttgctcac attcgtaaac gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaaattgat tatctttcct ttctttagtg tcttt
//