Typing tool

Complete norovirus genomes

AB972483  GII.4 Sydney
 GII.P31

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB972483                7509 bp    RNA     linear   VRL 08-JAN-2016
DEFINITION  Norovirus Hu/GII.4/Ehime5/2012/JP RNA, complete sequence.
ACCESSION   AB972483
VERSION     AB972483.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Ehime5/2012/JP
  ORGANISM  Norovirus Hu/GII.4/Ehime5/2012/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Evidence for antigenic variation in norovirus outbreaks in Japan
            between 2006 and 2012
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Ehime5/2012/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Ehime5/2012/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1518355"
                     /country="Japan:Ehime"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAU24881.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKETPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLTMTERVGKQLKDVKTM
                     SDLKQALKNIAIKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAU24882.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFETNQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAU24883.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSFPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWAGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ccaatagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gaaacaccac ccagaccccc gcgaccaccc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaatcatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccattagc
      481 cttgccaagg tcgagctagc accgctctct ttgttctgga gacctgtata caccccccag
      541 tatctcatct ctccagacac tcttaggaga ttacatggag agtcattccc ctacactgca
      601 tttgacaaca attgctacgc cttttgttgt tgggtactag acctaaacga ctcatggcta
      661 agcaggagaa tgattcagag aacaacaggt ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatt aaggacataa tagggaagtt gaaacctctt
      841 aacatcctta acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcctta
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aatcggaaag
     1081 atgctatcgt ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggtcat gaagtggttc ttcccaaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagta ctagacctcg aggcaattga gaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa actctcaacc aaatctgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgctgct gcacgctccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gcaggccgag acctgtcgtt gtgatgatat cgggaagacc agggataggg
     1501 aaaactcacc ttgccaggga gctggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgtgtgggtc ttatcccacg caatggtgtc gaccactggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgagc aaccccatcc atgatgccct caggttgcag
     1681 gagcttgctg acacttgccc cctcacacta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgc attgatttcc tcgtgtacgc agaagcccct
     1861 gaggtggaga aggcaaagcg cgacttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggagtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccagccctc
     2101 accactttca actttgaccg caacaagata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgacgatgac agagagagtt ggaaaacagc tcaaggatgt caagaccatg
     2221 tcagacctca aacaagcact caagaacatc gcgatcaaga agtgccagat agtgtacaat
     2281 ggtggcacct acacacttga ggctgatggc aagggtagtg tgaaagttga caaagtacaa
     2341 agtgccactg tgcagaccaa caatgaacta gccggtgccc tacaccacct aaggtgcgct
     2401 agaatcagat actatgttaa gtgcgtccag gaggcactgt attccatcat ccaaatcgct
     2461 ggggctgcat tcgtcaccac gcgcatcgct aagcgcatga atatacagaa tctctggtcc
     2521 aagccacagg tggaagacac agaagagatg gccaacaaag atggttgcct aaaacccaaa
     2581 gatgatgaag agtttgtcgt ctcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagtccg gccgtggcaa gaagcacaca gccttttcaa gcaaagggct cagtgatgag
     2701 gagtacgatg agtacaagag aatcagagaa gaaaggaatg gtaagtactc catagaagag
     2761 taccttcagg acagagacag gtactacgag gaggtggcca ttgccagggc aaccgaagag
     2821 gacttctgtg aagaagaaga ggccaaaatc cggcagagaa ttttcagacc aacaaggaaa
     2881 caacgcaaag aagagagggc ctctctcggc ttggtcacag gctctgaaat caggaagaga
     2941 aacccagaag acttcaaacc caagggaaag ctgtgggctg atgatgacag aagtgttgac
     3001 tacaatgaga aactcaactt tgaggcccca ccaagcatct ggtcgcggat agtcaacttt
     3061 ggttcaggct ggggcttctg ggtctccccc agtctgttta taacatcaac ccatgtcata
     3121 ccccaaggtg caaaagagtt cttcggagtc cctatcaagc aaatccagat acacaaatca
     3181 ggtgaattct gccggttgag attcccaaag ccgatcagaa ctgatgtgac gggcatgatt
     3241 ctagaagaag gtgcgcccga ggggaccgtg gccacactgc tcatcaagag accaactgga
     3301 gagctcatgc ctctggcagc cagaatgggg acccatgcaa ccatgaaaat tcaggggcgc
     3361 acagttggag ggcaaatggg tatgctcctg acaggatcca acgccaagag tatggaccta
     3421 ggcacaacac caggcgactg cggctgcccc tacatctaca agagggggaa tgactacgtg
     3481 gtcataggag tccatacggc cgctgcccgt ggaggaaaca ctgtcatatg tgccacccag
     3541 gggagtgagg gagaagccac acttgaagga ggtgacagta aagggacata ctgtggcgca
     3601 ccaatcttgg gcccagggag cgctccaaag ctcagtacca agactaagtt ttggagatca
     3661 tccacaacac cactcccacc tggcacctac gaaccagcct acctcggtgg caaagaccct
     3721 agagtcaaag gtggcccttc attgcaacaa gttatgaggg accagctgaa gccattcaca
     3781 gaacccagag gcaaaccacc aagaccaaat gtgttggaag ctgccaagaa aaccatcatc
     3841 aatgtccttg agcaaacaat tgatccaccc caaaaatggt catttgcgca agcttgcgca
     3901 tcccttgaca aaaccacctc cagcggccac ccgcaccaca tgcggaaaaa cgactgttgg
     3961 aatggggagt ccttcacagg aaaattggct gatcaagcct ccaaggccaa cctaatgttt
     4021 gaagagggaa agaacatgac tccagtctac acaggtgcac ttaaagatga gttggtaaag
     4081 accgataaag tttatggtaa ggtcaagaag aggcttctgt ggggttcaga tctggcgacc
     4141 atgatacggt gcgcccgagc ttttggaggc cttatggatg aactcaaggc acactgtgtc
     4201 acacttcctg tcagagttgg tatgaacatg aatgaggatg gccccatcat ctttgagaag
     4261 cactccagat atagatatca ttatgatgct gattattccc ggtgggactc aacacaacaa
     4321 agggatgtgc tagcagcagc actagaaatc atggttaagt tctctccaga accacacctg
     4381 gcccagatag ttgcagaaga cctcctttcc cctagcgtaa tggatgtagg tgactttcaa
     4441 atatcaataa gtgagggtct cccctctggg gtgccttgta cctcccagtg gaattccatc
     4501 gcccactggc tcctcactct gtgtgcactc tctgaagtca cggacctgtc ccctgatatc
     4561 attcaggcca actccctttt ctccttctat ggtgatgatg agattgtaag cacagacata
     4621 aagttggacc cagagaagct gacagcaaaa ctcaaggagt acgggctgaa accaacccgc
     4681 cccgacaaaa ctgaaggacc ccttgttatc tctgaagacc tggatggcct gacattcctc
     4741 cggagaactg tgacccgtga tccagctggc tggtttggaa aattggaaca aagttcaatt
     4801 ctcaggcaaa tgtactggac caggggtccc aaccatgaag acccatttga aacaatgata
     4861 ccacactccc aaagacccat acaattgatg tccttgctgg gcgaggctgc actccacggc
     4921 ccggcattct atagcaaaat tagcaaacta gtcattgcag agttgaagga aggtggcatg
     4981 gatttttacg tgcccagaca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctctggag cccgttgttg gtgccgccat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt ttacagtatc
     5281 ccctagaaac gctccaggtg aaatcttatg gagcgcgccc ttgggccctg atctaaatcc
     5341 ctacctatcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aattctcgcg gggaacgcgt tcaccgccgg gaaggtcata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttga gccccagcca ggtcactatg ttcccccata tagtagtaga
     5521 tgttaggcaa ctagaacctg tgttgattcc cttacccgat gttaggaata atttctacca
     5581 ttacaatcaa tcaaatgacc ccaccattaa gttgatagca atgttgtata caccacttag
     5641 ggctaataat gctggggatg atgtcttcac agtttcttgc cgagttctca cgagaccatc
     5701 ccccgatttt gatttcatat ttctagtgcc acccacagtt gagtcaagaa ctaaaccatt
     5761 ctctgtccca gttttaactg ttgaggagat gaccaattca agattcccca ttcctttgga
     5821 aaagttgttc acgggtccca gcagtgcctt tgttgtccaa ccacaaaacg gtaggtgcac
     5881 gactgatggc gtgctcctag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggagatgtc acccatatca caggtagtcg taactacaca atgaatttgg cttctcaaaa
     6001 ttggaacaat tatgacccaa cagaagaaat cccagcccct ctaggaactc cagattttgt
     6061 ggggaagatt caaggcgtgc tcacccaaac cacaaggaca gatggctcaa cacgcggcca
     6121 caaagctaca gtgtacactg ggagcgccga ttttgctcca aaactgggta gagttcaatt
     6181 tgaaactgac acagaccatg actttgaaac taaccaaaac acaaagttca ccccagttgg
     6241 tgtcatccaa gatggtggca ccacccaccg aaatgaaccc caacagtggg tgctcccaag
     6301 ttactcaggc agaaatactc ctaatgtgca tctggccccc gctgtagccc ccacttttcc
     6361 gggtgagcaa cttctcttct tcagatccac catgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctgctcc cccaggaatg ggtgcagtac ttctaccaag aggcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaatcca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataaat caggctatgt tacagtggct cacactggtc aacatgattt
     6601 ggttatcccc cccaatggtt atttcaggtt tgattcctgg gtcaaccagt tttacacgct
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcacta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggctct ggacttggtt cccttatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgagtttgaa aataacagaa aattgcaaca agcatccttc
     6841 caatttagca gcaatctaca acaggcttcc tttcaacatg acaaagagat gctccaagca
     6901 caaattgagg ccaccaaaag gctacaacag gaaatgatga aagttaagca ggcaatgctc
     6961 ctagagggtg ggttctctga gacagatgca gcccgcgggg caatcaacgc ccccatgaca
     7021 aaagctttgg actggagcgg gacaaggtac tgggctcccg atgctaggac tacaacatac
     7081 aatgcaggcc gcttttccac ccctcaacca tcgggggcac tgccaggaag agctaatctt
     7141 agggatgctg tccctgctcg gggttcctcc agcaagtctt ctaattcttc tactgctact
     7201 tctgtgtact caaatcaaac tacttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 agtgtctcga gcttcccgtc aactgcaagg actaggagct gggttgagga tcaaagtagg
     7321 aatttgtcac ctttcatgag gggggcccac aacatatcgt ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag agattttgga ctcctgggct
     7441 ggcgctttca acacgcgcag gcagccactc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggcgtaa
//