Typing tool

Complete norovirus genomes

AB972477  GII.4 Sydney
 GII.P31

Length: 7,476 | 3 CDS

ORF1: 1..5067
ORF2: 5048..6670
ORF3: 6670..7476
LOCUS       AB972477                7476 bp    RNA     linear   VRL 08-JAN-2016
DEFINITION  Norovirus Hu/GII.4/Niigata4/2012/JP RNA, complete sequence.
ACCESSION   AB972477
VERSION     AB972477.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Niigata4/2012/JP
  ORGANISM  Norovirus Hu/GII.4/Niigata4/2012/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Evidence for antigenic variation in norovirus outbreaks in Japan
            between 2006 and 2012
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7476)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7476
                     /organism="Norovirus Hu/GII.4/Niigata4/2012/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Niigata4/2012/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1518349"
                     /country="Japan:Niigata"
     CDS             1..5067
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAU24863.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLTMTRMSDLKQALKNIA
                     IKKCQIVYNGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLRCARIRYYVKCV
                     QEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGCLKPKDDEEFVV
                     SSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKYSIEEYLQDR
                     DRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLVTGSEIRKRNPE
                     DFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSPSLFITSTHVIP
                     QGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEGTVATLLIKRPT
                     GELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDCGCPYIYKRGN
                     DYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILGPGSAPNLSTKT
                     KFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPRPNVLE
                     AAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLAD
                     QASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSDLATMIRCARAFG
                     GLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWDSTQQRDVLAAA
                     LEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCTSQWNSIAHWLL
                     TLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDK
                     TEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPFETMIP
                     HSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDL
                     STWEGDRNLAPSFVNEDGVE"
     CDS             5048..6670
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAU24864.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDRDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6670..7476
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAU24865.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKTLDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSFPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gaaataccac ccagaccccc gcgaccaccc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaatcatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccattagc
      481 cttgccaagg tcgagctagc accgctctct ttgttctgga gacctgtata caccccccag
      541 tatctcatct ctccagacac tcttaggaga ttacatggag agtcattccc ctacactgca
      601 tttgacaaca attgctacgc cttttgttgt tgggtattag acctaaacga ctcatggcta
      661 agcaggagaa tgattcagag aacaacaggc ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatt aaggacataa tagggaagtt gaaacctctt
      841 aacatcctta acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcctta
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aatcggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggtcat gaagtggttc ttcccaaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagta ctagacctcg aggcaattga aaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa actctcaacc aaatctgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgctgct gcacgctccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gcaggccgag acctgtcgtt gtgatgatat cgggaagacc agggataggg
     1501 aaaactcacc ttgccaggga gctggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgtgtgggtc ttatcccgcg caatggtgtc gaccactggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgagc aaccccatcc atgatgccct caggttgcag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgc attgatttcc tcgtgtacgc agaagcccct
     1861 gaggtggaga aggcaaagcg cgacttcccg ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccagccctc
     2101 accactttca actttgaccg caacaagata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgacgatgac aagaatgtca gacctcaaac aagcacttaa gaacatcgcg
     2221 atcaagaagt gccagatagt gtacaatggt ggcacctaca cacttgaggc tgatggcaag
     2281 ggtagtgtga aagttgacaa agtgcaaagt gccactgtgc agaccaacaa tgaactagcc
     2341 ggtgccctac accacctaag gtgcgctaga atcagatact atgttaagtg cgtccaggag
     2401 gcactgtatt ccatcatcca aatcgctggg gctgcattcg tcaccacgcg catcgctaag
     2461 cgcatgaaca tacagaatct ctggtccaag ccacaggtgg aagacacaga agagatggcc
     2521 aacaaagatg gttgcctaaa acccaaagat gatgaagagt ttgtcgtctc atccgacgac
     2581 atcaaaactg agggcaagaa agggaagaac aagtccggcc gtggcaagaa gcacacagcc
     2641 ttttcaagta aagggctcag tgatgaggag tacgatgagt acaagagaat cagagaagaa
     2701 aggaatggta agtactccat agaagagtac cttcaggaca gagacaggta ctacgaggag
     2761 gtggccattg ccagggcaac cgaagaggac ttctgtgaag aagaagaggc caaaatccgg
     2821 cagagaattt ttagaccaac aaggaaacaa cgcaaagaag agagggcctc tctcggcttg
     2881 gtcacaggct ctgaaatcag gaagagaaac ccagaagact tcaaacccaa gggaaagctg
     2941 tgggctgatg atgacagaag tgttgactac aatgagaaac tcaactttga ggccccacca
     3001 agcatctggt cgcggatagt caactttggt tcaggctggg gcttctgggt ctcccccagt
     3061 ctgtttataa catcaaccca tgtcataccc caaggtgcaa aagagttctt cggagtccct
     3121 atcaagcaaa tccagataca caagtcaggt gaattctgcc ggttgaggtt cccaaagcca
     3181 atcagaactg atgtgacggg catgattcta gaagaaggtg cgcccgaggg gaccgtggcc
     3241 acactgctca tcaagagacc aactggagag ctcatgcctc tggcagccag aatggggacc
     3301 catgcaacca tgaaaattca ggggcgcaca gttggagggc aaatgggtat gctcctgaca
     3361 ggatccaacg ccaagagtat ggacctaggc acaacaccag gcgactgcgg ctgcccctac
     3421 atctacaaga gggggaatga ctacgtggtc ataggagtcc atacggccgc tgcccgtgga
     3481 ggaaacactg tcatatgtgc cacccagggg agtgagggag aagccacact tgaaggaggt
     3541 gacagtaaag ggacatactg tggcgcacca atcttgggcc cagggagcgc tccgaatctc
     3601 agtaccaaga ctaagttttg gaggtcatcc acaacaccac tcccacctgg cacctacgaa
     3661 ccagcctacc tcggtggcaa agaccctaga gtcaagggtg gcccttcatt gcaacaagtt
     3721 atgagggacc agctgaagcc attcacagaa cccagaggca aaccaccaag accaaatgtg
     3781 ttggaagctg ccaagaaaac catcatcaat gtccttgagc aaacaattga tccaccccaa
     3841 aaatggtcat ttgcgcaagc ttgcgcatcc cttgacaaaa ccacctccag cggccacccg
     3901 caccacatgc ggaaaaacga ctgttggaat ggggagtcct tcacaggaaa attggctgat
     3961 caagcctcca aggccaacct aatgtttgaa gagggaaaga acatgactcc agtctacaca
     4021 ggtgcactta aagatgagtt ggtaaagacc gataaagttt atggtaaggt caagaagagg
     4081 cttctgtggg gttcagatct ggcgaccatg atacggtgcg cccgagcttt tggaggcctt
     4141 atggatgaac tcaaggcaca ctgtgtcaca cttcctgtca gagttggtat gaacatgaat
     4201 gaggatggcc ccatcatctt tgagaagcac tccagatata gatatcacta tgatgctgat
     4261 tattcccggt gggactcaac acaacaaagg gatgtgctag cagcagcact agaaatcatg
     4321 gttaagttct ctccagaacc acacctggcc cagatagttg cagaagacct cctttcccct
     4381 agcgtgatgg atgtaggtga ctttcaaata tcaataagtg agggtctccc ctctggggta
     4441 ccttgtacct cccagtggaa ttccatcgcc cactggctcc tcactctgtg tgcactctct
     4501 gaagtcacgg acctgtcccc tgatatcatt caggccaact cccttttctc cttctatggt
     4561 gatgatgaga ttgtaagcac agacataaag ttggacccag agaagctgac agcaaaactc
     4621 aaggagtacg ggctgaaacc aacccgcccc gacaaaactg aaggacccct tgttatctct
     4681 gaagacctgg atggcctgac attcctccgg agaactgtga cccgtgatcc agctggctgg
     4741 tttggaaaat tggaacaaag ttcaattctc aggcaaatgt actggaccag gggtcccaac
     4801 catgaagatc catttgaaac aatgatacca cactcccaaa gacccataca attgatgtcc
     4861 ctgctgggcg aggctgcact ccacggcccg gcattctata gcaaaattag caaattagtc
     4921 attgcagagt tgaaggaagg tggcatggat ttttacgtac ccagacaaga gccaatgttc
     4981 agatggatga gattctcaga tctgagcacg tgggagggcg atcgcaatct ggctcccagt
     5041 tttgtgaatg aagatggcgt cgagtgacgc caacccatct gatgggtccg cagccaacct
     5101 cgtcccagag gtcaacaatg aggttatggc tctggagccc gttgttggtg ccgccattgc
     5161 ggcacctgta gcgggccaac aaaatgtaat tgacccctgg attagaaata attttgtaca
     5221 agcccctggt ggagagttta cagtatcccc tagaaacgct ccaggtgaaa tactatggag
     5281 cgcgcccttg ggccctgatc taaatcccta cctatcccat ttggccagaa tgtacaatgg
     5341 ttatgcaggt ggttttgaag tgcaggtaat tctcgcgggg aacgcgttca ccgccgggaa
     5401 ggtcatattt gcagcagtcc caccaaattt tccaactgaa ggcttgagcc ccagccaggt
     5461 cactatgttc ccccatatag tagtagatgt taggcaacta gaacctgtgt tgattccctt
     5521 acccgatgtt aggaataatt tctatcatta caatcaatca aatgacccca ccattaagtt
     5581 gatagcaatg ttgtatacac cacttagggc taataatgct ggggatgatg tcttcacagt
     5641 ctcttgccga gttctcacga gaccatcccc cgattttgat ttcatatttc tagtgccacc
     5701 cacagttgag tcaagaacta aaccattctc tgtcccagtt ttaactgttg aggagatgac
     5761 caattcaaga ttccccattc ctttggaaaa gttgttcacg ggtcccagca gtgcctttgt
     5821 tgtccaacca caaaacggta ggtgcacgac tgatggcgtg ctcctaggca ccacccaact
     5881 gtctcctgtc aacatctgca ccttcagagg agatgtcacc catatcacag gtagtcgtaa
     5941 ctacacaatg aatttggctt ctcaaaattg gagcaattat gacccaacag aagaaatccc
     6001 agcccctcta ggaactccag attttgtggg gaagattcaa ggcgtgctca cccaaaccac
     6061 aaggacagat ggctcaacac gcggccacaa agccacagtg tacactggga gcgccgactt
     6121 tgctccaaaa ctgggtagag ttcaatttga aactgacaca gaccgtgatt ttgaagctaa
     6181 ccaaaacaca aagttcaccc cagttggtgt catccaagat ggtagcacca cccaccgaaa
     6241 tgaaccccaa cagtgggtgc tcccaagtta ctcaggcaga aatactccta atgtgcatct
     6301 ggcccccgct gtagccccca cttttccggg tgagcaactt ctcttcttca gatccaccat
     6361 gcccggatgc agcgggtacc ccaacatgga tttggactgt ctgctccccc aggaatgggt
     6421 gcagtacttc taccaagagg cagccccagc acaatctgat gtggctctgc taagatttgt
     6481 gaatccagac acaggtaggg ttttgtttga gtgtaagctt cataaatcag gctatgttac
     6541 agtggctcac actggccaac atgatttggt tatccccccc aatggttatt ttaggtttga
     6601 ttcctgggtc aaccagtttt acacgcttgc ccccatggga aatggaacgg ggcgtagacg
     6661 tgcactataa tggctggagc tttctttgct ggattggcat ctgatgtcct tggctctgga
     6721 cttggttccc ttatcaatgc tggggctggg gccatcaacc aaaaagttga gtttgaaaat
     6781 aacagaaaat tgcaacaagc atccttccaa tttagcagca atctacaaca ggcttccttt
     6841 caacatgaca aagagatgct ccaagcacaa attgaggcca ccaaaaggct acaacaggaa
     6901 atgatgaaag ttaagcaggc aatgctccta gagggtgggt tctctgagac agatgcagcc
     6961 cgcggggcaa tcaacgcccc catgacaaaa actttggact ggagcgggac aaggtactgg
     7021 gctcccgatg ctaggactac aacatacaat gcaggccgct tttccacccc tcaaccatcg
     7081 ggggcactgc caggaagagc taatcttagg gatgctgtcc ctgctcgggg ttcctccagt
     7141 aagtcttcta attcttctac tgctacttct gtgtactcaa atcaaactac ttcaacgaga
     7201 cttggttcta cagctggttc tggtaccagt gtctcgagct tcccgtcaac tgcaaggact
     7261 aggagctggg ttgaggatca aagtaggaat ttgtcacctt tcatgagggg ggcccacaac
     7321 atatcgtttg tcaccccacc atctagcaga tcctctagcc aaggcacagt ctcaaccgtg
     7381 cctaaagaga ttttggactc ctggactggc gctttcaaca cgcgcaggca gccactcttc
     7441 gctcacattc gtaagcgggg ggagtcacgg gcgtaa
//