Typing tool

Complete norovirus genomes

AB972472  GII.4 Sydney
 GII.P31

Length: 7,452 | 3 CDS

ORF1: 1..5043
ORF2: 5024..6646
ORF3: 6646..7452
LOCUS       AB972472                7452 bp    RNA     linear   VRL 08-JAN-2016
DEFINITION  Norovirus Hu/GII.4/Iwate4/2012/JP RNA, complete sequence.
ACCESSION   AB972472
VERSION     AB972472.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Iwate4/2012/JP
  ORGANISM  Norovirus Hu/GII.4/Iwate4/2012/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Evidence for antigenic variation in norovirus outbreaks in Japan
            between 2006 and 2012
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7452)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7452
                     /organism="Norovirus Hu/GII.4/Iwate4/2012/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Iwate4/2012/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1518344"
                     /country="Japan:Iwate"
     CDS             1..5043
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAU24848.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTLTTFNFDRNKILAFRQLAAENKYGLTMTLKNVAIKKCQIVY
                     NGGTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLRCARIRYYVKCVQEALYSII
                     QIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGCLKPKDDEEFVVSSDDIKTE
                     GKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKYSIEEYLQDRDRYYEEVA
                     IARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLVTGSEIRKRNPEDFKPKGKL
                     WADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSPSLFITSTHVIPQGAKEFFG
                     VPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEGTVATLLIKRPTGELMPLAA
                     RMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDCGCPYIYKRGNDYVVIGVH
                     TAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILGPGSAPKLSTKTKFWRSSTT
                     PLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPRPNVLEAAKKTIIN
                     VLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLM
                     FEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSDLATMIRCARAFGGLMDELKA
                     HCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWDSTQQRDVLAAALEIMVKFS
                     PEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCTSQWNSIAHWLLTLCALSEV
                     TDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVIS
                     EDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPFETMIPHSQRPIQL
                     MSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRN
                     LAPSFVNEDGVE"
     CDS             5024..6646
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAU24849.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWSNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDRDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6646..7452
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAU24850.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPTGALPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSFPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gaaataccac ccagaccccc gcgaccaccc
      181 acaccagaat tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtctcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaatcatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccattagc
      481 cttgccaagg tcgagctagc accgctctct ttgttctgga gacctgtata caccccccag
      541 tatctcatct ctccagacac tcttaggaga ttacatggag agtcattccc ctacactgca
      601 tttgacaaca attgttacgc cttttgttgt tgggtattag acctaaacga ctcatggcta
      661 agcaggagaa tgattcagag aacaacaggc ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatt aaggacataa tagggaagtt gaaacctctt
      841 aacatcctca acattctggc tacatgtgat tggaccttcg caggcatagt ggaatcctta
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aatcggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggtcat gaagtggttc ttcccaaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagta ctagacctcg aggcaattga aaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa actctcaacc aaatctgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgctgct gcacgctccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gcaggccgag acctgtcgtt gtgatgatat cgggaagacc agggataggg
     1501 aaaactcacc ttgccaggga gctggccaag aagatcgcgg cctccctcac aggggaccag
     1561 cgtgtgggtc ttatcccacg caatggtgtc gaccactggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgagc aaccccatcc atgatgccct caggttgcag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattatcacc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgc attgatttcc tcgtgtacgc agaagcccct
     1861 gaggtggaga aggcaaagcg cgacttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatcag ggttactcca tgagaggcta gatgaatatg aactgcaagg cccaaccctc
     2101 accactttca actttgaccg caacaagata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgacgatgac actcaagaac gtcgcgatca agaagtgcca gatagtgtac
     2221 aatggtggca cctacacact tgaggctgat ggcaagggta gtgtgaaagt tgacaaagtg
     2281 caaagtgcca ctgtgcagac caacaatgaa ctagccggtg ccctacacca cctaaggtgc
     2341 gctagaatca gatactatgt taagtgcgtc caggaggcac tgtattccat catccaaatc
     2401 gctggggctg cattcgtcac cacgcgcatc gctaagcgca tgaatataca gaatctctgg
     2461 tccaagccac aggtggaaga cacagaagag atggccaaca aagatggttg cctaaaaccc
     2521 aaggatgatg aagagtttgt cgtctcatcc gacgacatca aaactgaggg caagaaaggg
     2581 aagaacaagt ccggccgtgg caagaagcac acagcctttt caagtaaagg gctcagtgat
     2641 gaggagtacg atgagtacaa gagaatcaga gaagaaagga atggtaagta ctccatagaa
     2701 gagtaccttc aggacagaga caggtactac gaggaggtgg ccattgccag ggcaaccgaa
     2761 gaggacttct gtgaagaaga agaggccaaa atccggcaga gaatttttag accaacaagg
     2821 aaacaacgca aagaagagag ggcctctctc ggcttggtca caggctctga aatcaggaag
     2881 agaaacccag aagacttcaa acccaaggga aagctgtggg ctgatgatga cagaagtgtt
     2941 gactacaatg agaaactcaa ctttgaggcc ccaccaagca tctggtcgcg gatagtcaac
     3001 tttggttcag gctggggctt ctgggtctcc cccagtctgt ttataacatc aacccatgtc
     3061 ataccccaag gtgcaaaaga gttcttcgga gtccctatca agcaaatcca gatacacaag
     3121 tcaggtgaat tctgccggtt gagattccca aagccaatca gaactgatgt gacgggcatg
     3181 attctagaag aaggtgcgcc cgaggggacc gtggccacac tgctcatcaa gagaccaact
     3241 ggagagctca tgcctctggc agccagaatg gggacccatg caaccatgaa aattcagggg
     3301 cgcacagttg gagggcaaat gggtatgctc ctgacaggat ccaacgccaa gagtatggac
     3361 ctaggcacaa caccaggcga ctgcggctgc ccctacatct acaagagggg gaatgactac
     3421 gtggtcatag gagtccatac ggccgctgcc cgtggaggaa acactgtcat atgtgccacc
     3481 caggggagtg agggagaagc cacacttgaa ggaggtgaca gtaaagggac atactgtggc
     3541 gcaccaatct tgggcccagg gagcgctccg aagctcagta ccaagactaa gttttggaga
     3601 tcatccacaa caccactccc acctggcacc tacgaaccag cctacctcgg tggcaaagac
     3661 cctagagtca aaggtggccc ttcattgcaa caagttatga gggaccagct gaagccattc
     3721 acagaaccca gaggcaaacc accaagacca aatgtgttgg aagctgccaa gaaaaccatc
     3781 atcaatgtcc ttgagcaaac aattgatcca ccccaaaaat ggtcatttgc gcaagcttgc
     3841 gcatcccttg acaaaaccac ctccagcggc cacccgcacc acatgcggaa aaacgactgt
     3901 tggaatgggg agtccttcac aggaaaattg gctgatcaag cctccaaggc caacctaatg
     3961 tttgaagagg gaaagaacat gactccagtc tacacaggtg cacttaaaga tgagttggta
     4021 aagaccgata aagtttatgg taaggtcaag aagaggcttc tgtggggttc agatctggcg
     4081 accatgatac ggtgcgcccg agcttttgga ggccttatgg atgaactcaa ggcacactgt
     4141 gtcacacttc ctgtcagagt tggtatgaac atgaatgagg atggccccat catctttgag
     4201 aagcactcca gatatagata tcactatgat gctgattatt cccggtggga ctcaacacaa
     4261 caaagggatg tgctagcagc agcactagaa atcatggtta agttctctcc agaaccacac
     4321 ctggcccaga tagttgcaga agacctcctc tcccctagcg tgatggatgt aggtgacttt
     4381 caaatatcaa taagtgaggg tctcccctct ggggtacctt gtacctccca gtggaattcc
     4441 atcgcccact ggctcctcac tctgtgtgca ctctctgaag tcacggacct gtcccctgat
     4501 atcattcagg ccaactccct tttctccttc tatggtgatg atgagattgt aagcacagac
     4561 ataaagttgg acccagagaa gctgacagca aaactcaagg agtacgggct gaaaccaacc
     4621 cgccccgaca aaactgaagg accccttgtt atctctgaag acctggatgg cctgacattc
     4681 ctccggagaa ctgtgacccg tgatccagct ggctggtttg gaaaattgga acaaagttca
     4741 attctcaggc aaatgtactg gaccaggggt cccaaccatg aagatccatt tgaaacaatg
     4801 ataccacact cccaaagacc catacaattg atgtccttgc tgggcgaggc tgcactccac
     4861 ggcccggcat tctatagcaa aattagcaaa ttagtcattg cagagttgaa ggaaggtggc
     4921 atggattttt acgtacccag acaagagcca atgttcagat ggatgagatt ctcagatctg
     4981 agcacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgag
     5041 tgacgccaac ccatctgatg ggtccgcagc caacctcgtc ccagaggtca acaatgaggt
     5101 catggctctg gagcccgttg ttggtgccgc cattgcggca cctgtagcgg gccaacaaaa
     5161 tgtaattgac ccctggatta gaaataattt tgtacaagcc cctggtggag agtttacagt
     5221 atcccctaga aacgctccag gtgaaatact atggagcgcg cccttgggcc ctgatctaaa
     5281 tccctaccta tcccatttgg ccagaatgta caatggttat gcaggtggtt ttgaagtgca
     5341 ggtaattctc gcggggaacg cgttcaccgc cgggaaggtc atatttgcag cagtcccacc
     5401 aaattttcca actgaaggct tgagccccag ccaggtcact atgttccccc atatagtagt
     5461 agatgttagg caactagaac ctgtgttgat tcccttaccc gatgttagga ataatttcta
     5521 tcattacaat caatcaaatg accccaccat taagttgata gcaatgttgt atacaccact
     5581 tagggctaat aatgctgggg atgatgtctt cacagtttct tgccgagtcc tcacgagacc
     5641 atcccccgat tttgatttca tatttctagt gccacccaca gttgagtcaa gaactaaacc
     5701 attctctgtc ccagttttaa ctgttgagga gatgaccaat tcaagattcc ccattccttt
     5761 ggaaaagttg ttcacgggtc ccagcagtgc ctttgttgtc caaccacaaa acggtaggtg
     5821 cacgactgat ggcgtgctcc taggcaccac ccaactatct cctgtcaaca tctgcacctt
     5881 cagaggagat gtcacccata tcacaggtag tcgtaactac acaatgaatt tggcttctca
     5941 aaattggagc aattatgacc caacagaaga aatcccagcc cctctaggaa ctccagattt
     6001 tgtggggaag attcaaggcg tgctcaccca aaccacaagg acagatggct caacacgcgg
     6061 ccacaaagcc acagtgtaca ctgggagcgc cgactttgct ccaaaactgg gtagagttca
     6121 atttgaaact gacacagacc gtgattttga agctaaccaa aacacaaagt tcaccccagt
     6181 tggtgtcatc caagatggta gcaccaccca ccgaaatgaa ccccaacagt gggtgctccc
     6241 aagttactca ggcagaaata ctcctaatgt gcatctggcc cccgctgtag cccccacttt
     6301 tccgggtgag caacttctct tcttcagatc caccatgccc ggatgcagcg ggtaccccaa
     6361 catggatttg gactgtctgc tcccccagga atgggtgcag tacttctacc aagaggcagc
     6421 cccagcacaa tctgatgtgg ctctgctaag atttgtgaat ccagacacag gtagggtttt
     6481 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6541 tttggttatc ccccccaatg gttattttag gtttgattcc tgggtcaacc agttttacac
     6601 gcttgccccc atgggaaatg gaacggggcg tagacgtgca ctgtaatggc tggagctttc
     6661 tttgctggat tggcatctga tgtccttggc tctggacttg gttcccttat caatgctggg
     6721 gctggggcca tcaaccaaaa agttgagttt gaaaataaca gaaaattgca acaagcatcc
     6781 ttccaattta gcagcaatct acaacaggct tcctttcaac atgacaaaga gatgctccaa
     6841 gcacaaattg aggccaccaa aaggctacaa caggaaatga tgaaagttaa acaggcaatg
     6901 ctcctagagg gtgggttctc tgagacagat gcagcccgcg gggcaatcaa cgcccccatg
     6961 acaaaagctt tggactggag cgggacaagg tactgggctc ccgatgctag gactacaaca
     7021 tacaatgcag gccgcttttc cacccctcaa ccaacggggg cactgccagg aagagctaat
     7081 cttagggatg ctgtccctgc tcggggttcc tccagtaagt cttctaattc ttctactgct
     7141 acttctgtgt actcaaatca aactacttca acgagacttg gttctacagc tggttctggc
     7201 accagtgtct cgagcttccc gtcaactgca aggactagga gctgggttga ggatcaaagt
     7261 aggaatttgt cacctttcat gaggggggcc cacaacatat cgtttgtcac cccaccatct
     7321 agcagatcct ctagccaagg cacagtctca accgtgccta aagagatttt ggactcctgg
     7381 actggcgctt tcaacacgcg caggcagcca ctcttcgctc acattcgtaa gcgaggggag
     7441 tcacgggcgt aa
//