Typing tool

Complete norovirus genomes

AB972471  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB972471                7509 bp    RNA     linear   VRL 08-JAN-2016
DEFINITION  Norovirus Hu/GII.4/Akita5/2012/JP RNA, complete sequence.
ACCESSION   AB972471
VERSION     AB972471.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Akita5/2012/JP
  ORGANISM  Norovirus Hu/GII.4/Akita5/2012/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Evidence for antigenic variation in norovirus outbreaks in Japan
            between 2006 and 2012
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Akita5/2012/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Akita5/2012/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1518343"
                     /country="Japan:Akita"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAU24845.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGVGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSIQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEDATNKDGC
                     PKPKDIEEFVISSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGTEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVAGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGNSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCITLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVRFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAU24846.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFETDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNVPNVHLAPAVAPTFPGEQLLFFRSIMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAU24847.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAVN
                     APMTKVLDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRVNPRTPTPARGSPNTSS
                     NASTATSLYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc ccccccgagg gaaataccac aaagaccccc acgaccacct
      181 accccagaac tggtcaaaaa gatccctcct cccccaccta acggagagga tgagctagtg
      241 gtttcttaca gtgccaaaga tggcgtttcc ggtttacctg agctctccac cgtcaggcag
      301 ccggaagaaa ctaatacggc cttcagtgtc cctccactca accagaggga gaatagggat
      361 gctaaggaac cactgactgg aacaattctg gaaatgtggg atggagagat ctaccattat
      421 ggcctatatg ttgagcgagg tcttgtgctg ggtgtgcaca aaccaccagc tgctattagc
      481 ctcgccaagg tcgaactaac accactctcc ttgttctgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttacacggag aaacattccc ctacacagcc
      601 ttcgacaaca attgctatgc cttttgttgc tgggtcctgg atctaaacga ctcgtggctg
      661 agcaggagaa tgatccagag aacaactggc ttcttcagac cttaccaaga ttggaatagg
      721 aaacctctcc ccactatgga tgactccaaa ttaaagaagg tggctaatat attcctgtgc
      781 accctgtctt cgctgttcac caggcccata aaagacataa tagggaagtt aagacccctc
      841 aacatcatca acatcctggc ttcatgtgat tggaccttcg caggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgactt cgagttacaa ggacctgagg accttgtagt ggagctcgtc
     1021 cctgtagtaa tggggggagt tggtttggtg ctagggttca ccaaagagaa aattggaaaa
     1081 atgttgtcat ctgctgcatc taccttgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttagtcat gaagtggttc ttcccgaaga aagaagaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcggta ctggatcttg aagcaattga aaacaaccac
     1261 atgaccacct tgcttaaaga caaagacagc ctggcaacct atatgagaac ccttgacctc
     1321 gaggaagaaa aagccagaaa actctcaacc aaatctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgccgct gcacgctcct tggtgcaccg agcgaaggag
     1441 gagctctcca gcagaccaag acctgtagtc ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctccctcac aggagaccag
     1561 cgtgtgggcc tcatcccacg caatggcgtc gaccactggg atgcgtataa gggggagagg
     1621 gttgtcctat gggacgacta cggaatgagc aatcccatcc acgacgccct caggctgcaa
     1681 gaactcgctg acacctgccc cctcactcta aattgtgaca ggattgagaa taaagggaag
     1741 gtctttgaca gcgatgtcat tatcatcacc actaacctgg ccaacccagc accactggac
     1801 tatgttaact ttgaggcgtg ctcgaggcgc attgatttcc tcgtgtatgc agaagccccc
     1861 gaggtcgaaa aggcgaagcg tgacttcccg ggtcaacctg acatgtggaa aaacgctttc
     1921 agttctgatt tctcacacat aaaactggca ttggctccac aaggtggctt tgataagaac
     1981 gggaacaccc cacacgggaa gggcgtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgggcatcag ggctactcca tgagagattg gatgagtttg aactacaggg cccagccctt
     2101 accaccttca actttgaccg caacaaagta cttgccttca ggcagcttgc tgctgaaaac
     2161 aaatacgggt tgatggacac aatgaaagtt gggaggcagc tcaaggatgt caaaaccatg
     2221 ccagaactta aacaagcact caagaatatc tcaatcaaga agtgccagat tgtgtatagt
     2281 ggttgcacct acacacttga gtctgatggt aagggcaatg tgaaagttga cagagttcag
     2341 agtacttcta ttcagaccaa caatgagctg gctggcgccc tacatcacct aaggtgcgcc
     2401 agaattaggt actatgtcaa gtgtgttcag gaggccctgt attctatcat ccagattgct
     2461 ggggctgcgt ttgtcaccac gcgcatcatc aagcgtgtga acattcaaga cttatggtcc
     2521 aagccacaag tggaaaacac agaggatgcc accaacaagg acgggtgccc aaaacccaaa
     2581 gatattgagg agttcgtcat ttcatctgac gacattaaaa ctgagggtaa gaaagggaag
     2641 aacaaatctg gccgtggcaa gaagcacaca gccttctcaa gtaaaggtct cagtgatgaa
     2701 gagtatgatg agtacaagag aattagagag gaaaggaatg gcaagtactc catagaagag
     2761 tacctacagg acagggacag atactatgag gaggtggcca ttgccagggc gaccgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcagacc aacaagaaag
     2881 caacgcaagg aagaaagggc ttctctcggt ttggtcacag gtactgaaat taggaaaagg
     2941 aacccagagg acttcaagcc taaggggaaa ctatgggctg acgatgacag aagtgtggac
     3001 tacaatgaaa aactcagctt tgaggcccca ccaagcattt ggtcaaggat agtcaacttt
     3061 ggctcaggtt ggggcttctg ggtctccccc agcctgttca taacatcaac ccacgttata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt gcacaagtca
     3181 ggcgaattct gtcgcttgag gttcccaaaa ccaatcagga ctgatgtggc tggcatgatc
     3241 ttggaagaag gtgcgcccga aggcaccgtg gtcacactac tcatcaaaag gtctactgga
     3301 gaactcatgc ccctagcagc tagaatgggg acccatgcaa ccatgaagat tcaggggcgc
     3361 actgttggag gtcagatggg catgcttctg acaggatcca acgccaaaag catggatcta
     3421 ggcaccacac caggtgactg cggctgtccc tacatctaca agagagggaa tgactatgtt
     3481 gtcattggag tccacacggc tgccgctcgt gggggaaaca ctgtcatttg tgccacccaa
     3541 gggggtgagg gggaagctac acttgaaggt ggtaacagta agggaacgta ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca aaaccaaatt ctggagatca
     3661 tccacagcac cactcccacc tggcacctat gaaccagcct acctaggtgg caaggatccc
     3721 agggtcaagg atggcccctc gttgcagcaa gtcatgaggg accagctgaa accatttaca
     3781 gagcccaggg gtaagccacc aaagccaagt gtgttagaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaagtggt cgttcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggaat ccttcacggg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagagggga agaacatgac cccagtctac acaggtgcac ttaaggatga gttagtcaaa
     4081 actgacaaaa tttatggtaa aatcaagaag agacttctct ggggctcgga tttagcaacc
     4141 atgatccggt gcgctcgagc attcggaggc ctgatggatg aactcaaagc acactgtatc
     4201 acacttccta tcagagttgg tatgaacatg aatgaggatg gtcccatcat cttcgagaag
     4261 cattccaggt acagatacca ctatgatgct gactactctc ggtgggattc aacacagcag
     4321 agagccgtgt tggcagctgc tctagaaatt atggttagat tctcctcaga accacatttg
     4381 gctcaggtgg tggcagaaga cctcctttct cctagcgtgg tggatgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcactct ctgtgcactc tccgaagtca caaatttgtc cccagacatc
     4561 atacaggcta attctctctt ctccttctat ggtgatgatg aaattgttag tacagacata
     4621 aaattagacc cagagaaatt gacagcaaag ctcaaggaat acggattgaa accaactcgc
     4681 cctgataaaa ctgaaggacc tcttgttatc tctgaagact tggatggttt gaccttcctg
     4741 cggagaaccg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatgaag atccatctga atcaatgatt
     4861 ccacactctc aaagacccat acaattgatg tccttactgg gagaggccgc gctccacggc
     4921 ccaacattct acagcaaaat cagcaaatta gtcattgcag agcttaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgaatga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgtcg gtgccgctat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtgtc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atctgaatcc
     5341 ctacctatct catctggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gattctcgcg gggaacgcgt tcaccgccgg aaaaattata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttga gtcccagtca ggtcaccatg ttcccccata taatagtgga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacctgat gttaggaata atttctacca
     5581 ctataatcag tcaaatgatt ctaccattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtcttcac agtctcttgt cgagttctca cgaggccatc
     5701 ccctgatttt gatttcatat ttttggtgcc acctacagtt gagtcaagaa ctaagccatt
     5761 tactgtccca atcctaactg ttgaagaaat gaccaactca aggttcccca ttcctttgga
     5821 gaagttgttc acgggtccca gcagtgcctt tgttgttcaa ccacaaaatg gcagatgcac
     5881 aactgatggc gtgctcttag gtaccaccca gctgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccacattg caggttctcg taattataca atgaatttgg cttctctaaa
     6001 ttggaacaac tatgacccaa cagaagaaat tccagcccct ctaggaactc cagatttcgt
     6061 gggaaagatc caaggtatgc tcactcaaac cacaaaggga gatggctcga cccgtggcca
     6121 taaagctaca gtttacactg ggagtgcccc cttcactcca aagctgggca gtgtccaatt
     6181 cgaaactgac acagaaaatg attttgaaac ccaccaaaac acaaaattca ccccagtcgg
     6241 tgtcatccag gatggtggca ccacccaccg aaatgaacct caacaatggg tgctcccgag
     6301 ttattcaggt agaaatgtcc ctaatgtaca cctagcccct gctgtagccc ccacttttcc
     6361 gggtgaacaa ctccttttct ttaggtccat tatgcccgga tgcagcgggt atcccaacat
     6421 ggacttggac tgcctgctac cccaggagtg ggtgcagcac ttctaccaag aggcagctcc
     6481 agcacaatct gatgtggctc tattgagatt tgtgaatcca gacacgggta gggtcctgtt
     6541 tgagtgcaaa cttcataagt caggctatgt cacagtggcc cataccggcc agcatgattt
     6601 ggtcatcccc cccaatggtt attttaggtt tgattcctgg gttaaccaat tctatacgct
     6661 tgcccccatg ggaaacggaa cggggcgtag acgtgctttg taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttagctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggctatca accaaaagat cgattttgaa aataacagaa aattgcagca agcttccttc
     6841 cagtttagca gtaatctaca acaggcttcc tttcaacatg acaaggagat gcttcaagca
     6901 caaattgagg ccactaaaaa gttgcaacag gaaatgatga aagtcaaaca ggcaatgctc
     6961 ctagaaggtg gattctctga aacagatgca gcccgtgggg cagtcaacgc ccctatgaca
     7021 aaggttttgg actggagcgg aacaaggtat tgggcccctg atgctaggac cacaacatac
     7081 aatgcaggcc gtttttccac ccctcaacct tcaggggcat tgccaggaag agtcaatccc
     7141 agaactccca cccccgctcg gggctccccc aacacatctt ctaatgcttc tactgctact
     7201 tctttgtatt caaatcaaac tgtttcaacg agacttggtt ctacagctgg ctctggcacc
     7261 aatgtctcga gtctcccgtc aactgcaagg actaggagtt gggttgagga tcaaagcaga
     7321 aatttgtcac ctttcatgag gggggctcac aacatatcgt tcgtcacccc accatctagt
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttta acacgcgcag gcagcctctc ttcgctcaca ttcgtaggcg aggggagtca
     7501 cgggtgtaa
//