Typing tool

Complete norovirus genomes

AB933763  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,512 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7512
LOCUS       AB933763                7512 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Osaka2/2011/JP genomic RNA, complete genome.
ACCESSION   AB933763
VERSION     AB933763.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Osaka2/2011/JP
  ORGANISM  Norovirus Hu/GII.4/Osaka2/2011/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus Hu/GII.4/Osaka2/2011/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Osaka2/2011/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498757"
                     /country="Japan:Osaka"
                     /collection_date="2011"
     CDS             1..5103
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30349.1"
                     /translation="MKMASNDASAAAVANSNNDEPQSSSDGMLSSMAVTFKRALGARP
                     KQPPPREKPQRPPRPPTPELVKNIPPPPPNGEDEVVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAREPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELAPLSLYWRPVYTPQYLISPDTLKKLSGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKIKKVANIFLCALSSLFTRPIKDIIGK
                     IRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRTM
                     PELKQALKNVSIKKCQIVYSGCTYILESDGKGNVKVDRIQSAAVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVENTEETTSKDGC
                     PKPKDDDEEFVISSDDIKAEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERN
                     GKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGL
                     VTGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVS
                     PSLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPE
                     GTVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGNNKGTYCGAPIL
                     GPGSAPTLSTKTKFWRSSTASLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTE
                     PRGKPPKPNVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDC
                     WNGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSD
                     LATMIRCARAFGGLMDELKAHCVALPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRW
                     DSTQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKL
                     REYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRG
                     PNHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQ
                     EPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5084..6706
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30350.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIPGSRNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTNGSTRGHKATVYTGSADFSPKLGRVQFATDTDNDFETNQNTKFTPVGVIQDG
                     STTPRNEPQQWVLPSYSGRNIHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6706..7512
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30351.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKTLDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRATVPARGSSSTSS
                     NSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacgaa
       61 ccgcaatctt caagtgacgg aatgctctct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc tcccccgagg gaaaaaccac aaagaccccc acgaccacct
      181 actccagaac tggttaaaaa tattccccct cccccaccca acggagagga tgaagtagtg
      241 gtttcttata gtgtcaaaga tggtgtttcc ggcttgcctg acctttccac cgtcaggcaa
      301 ccggaagaat ctaacacggc cttcagtgtc cctccactca atcagaggga gaatagagat
      361 gctagggaac cacttactgg aacaattctg gaaatgtggg acggggaaat ctaccattat
      421 ggcctgtatg tggagcgggg tcttgtactg ggtgtgcaca aaccaccagc tgccatcagc
      481 ctcgctaggg ttgagctagc accactctcc ttgtactgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttatccggag aaacgttccc ctacacagcc
      601 tttgacaaca actgttatgc cttttgttgc tgggtcctgg acctaaatga ctcgtggctg
      661 agcaggagaa tgatccagag aacaaccggt ttcttcaggc cctaccaaga ctggaatagg
      721 aaaccccttc ccactatgga tgactccaaa ataaagaagg tagctaacat attcctgtgt
      781 gctctgtcct cgctgttcac cagacccata aaagatataa tagggaagat aaggcctctt
      841 aacatcctca acatcttagc ctcatgtgat tggacttttg caggtatagt ggagtccctg
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac ttggtgacta cgagctacaa ggacctgagg accttgcagt tgagctcgtc
     1021 cccgtggtga tggggggaat tggtttggtg ctaggattca ccaaagagaa gattgggaaa
     1081 atgttgtcat ctgctgcgtc caccttgaga gcttgtaaag accttggtgc atatgggcta
     1141 gagatcctaa agttggttat gaagtggttc ttcccgaaga aggaagaggc aaatgagctg
     1201 gctatagtga ggtctatcga ggatgcagtc ctggatctcg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagacagt ctggcaacct atatgagaac acttgacctt
     1321 gaggaggaga aagccaggaa actctcaacc aagtctgcct cacccgacat cgtgggcaca
     1381 atcaacgccc tcctggcgag aatcgctgcc gcacgttctc tagtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag acctgtggtg ttgatgatat caggcaggcc aggaataggg
     1501 aagacccacc tcgctaggga agtggctaag agaatcgcag cctcccttac aggagaccag
     1561 cgtgtgggcc tcatcccacg caatggcgtc gaccattggg atgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgatta tggaatgagc aaccctatcc acgatgccct caggctgcaa
     1681 gaactcgctg acacttgccc cctcactcta aactgtgaca ggatcgaaaa caaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcacc actaatctgg ccaacccagc gccactggac
     1801 tatgtcaact ttgaagcatg ctcgaggcgc atcgacttcc tcgtgtatgc agaagcccct
     1861 gaagtcgaaa aggcgaagcg tgacttccca ggccagcctg acatgtggaa gaacgctttc
     1921 agtcctgatt tctcacacat aaaactagca ctggccccac agggtggttt cgacaagaac
     1981 gggaacaccc cacacggaaa gggcgttatg aagactctca ccactggctc ccttattgcc
     2041 cgggcatcag ggctactcca tgagaggtta gatgaatttg aactgcaggg cccagctctc
     2101 accaccttca atttcgatcg caataaggtg cttgccttta gacagcttgc tgctgaaaat
     2161 aaatatggat tgatggacac aatgagagtt gggaaacagc tcaaggatgt cagaaccatg
     2221 ccagaactca aacaagcact caagaatgtc tcaatcaaga agtgccaaat agtgtatagt
     2281 ggttgcacct acatacttga gtctgatggc aagggcaatg tgaaagttga cagaatccaa
     2341 agcgccgccg tgcagaccaa caatgagctg gctggtgccc tgcaccattt gaggtgcgcc
     2401 agaatcagat actatgtcaa gtgtgtccag gaggccctgt attccatcat tcaaatcgct
     2461 ggggctgcat ttgtcaccac gcgcattgcc aagcgcatga acatacaaga cctatggtcc
     2521 aagccacaag tggaaaacac agaggagact accagcaagg acgggtgccc aaaacctaag
     2581 gacgatgatg aggagtttgt catttcatcc gacgacatca aagctgaggg taagaaaggg
     2641 aagaacaaga ctggccgcgg caagaagcac acagcatttt caagcaaagg tctcagtgat
     2701 gaagagtacg atgagtacaa gaggattaga gaagaaagga atggcaagta ctccatagaa
     2761 gagtaccttc aggacaggga caaatactat gaggaggtgg ccattgccag ggcgactgag
     2821 gaagacttct gtgaagagga ggaggccaag atccggcaaa ggatctttag gccaacaagg
     2881 aaacaacgca aggaggaaag agcctctctc ggtctggtca caggctctga aattaggaaa
     2941 agaaacccag atgacttcaa acccaaaggg aaattgtggg ctgacgatga caggagtgta
     3001 gactacaatg agaaactcag ttttgaggcc ccaccaagca tctggtcgag aatagtcaac
     3061 tttggttcag gctggggatt ttgggtctcc cccagtctgt tcataacatc aacccatgtc
     3121 ataccccagg gcgcaaagga gttctttgga gtccccatca aacaaataca ggtacacaag
     3181 tcgggcgagt tctgtcgctt gagattccca aaaccaatca ggactgatgt gacgggcatg
     3241 atcttagaag aaggcgcacc tgagggcacc gtggtcacac tactcatcaa aaggtccact
     3301 ggggaactca tgcccctagc agctaggatg gggacccatg cgaccatgaa gatccaaggg
     3361 cgcactgttg gaggccagat gggcatgctt ctgacaggat ccaacgccaa gagcatggac
     3421 ctgggtacca caccaggtga ttgtggctgc ccctatatct acaagagagg taatgactat
     3481 gtggtcattg gggtccacac ggctgccgca cgtgggggga acactgtcat atgtgccacc
     3541 caggggagtg aaggagaggc tacacttgaa ggtggtaaca acaaggggac atactgtggt
     3601 gcaccaatcc taggcccagg gagtgcccca acacttagca ccaagaccaa attctggaga
     3661 tcgtccacag catcactccc acctggcacc tatgaaccag cctatcttgg tggcaaggac
     3721 cctagggtca agggtggccc ttcactgcag caagtcatga gggaacagtt gaagccattc
     3781 acagagccca ggggcaagcc accaaaacca aatgtattag aagctgccaa gaagaccatc
     3841 atcaatgtcc ttgagcaaac aattgatcca ccagagaaat ggtcgttcgc acaagcttgc
     3901 gcgtcccttg acaagaccac ttccagtggt catccgcacc acatgcggaa aaacgactgc
     3961 tggaacgggg agtccttcac aggcaagctg gcagaccagg cttccaaggc caacctgatg
     4021 tttgaagaag ggaagaacat gaccccagtc tacacagctg cgctcaagga tgagttagtt
     4081 aaaactgaca aaatttatgg taagattaag aagaggcttc tctggggctc ggacttggcg
     4141 accatgatcc ggtgtgctcg agcattcgga ggcctaatgg atgaactcaa agcacactgt
     4201 gtcgcacttc ctattagagt tggcatgaat atgaatgagg atggccccat catcttcgag
     4261 aggcattcca ggtacacata tcactatgat gctgattact ctcgatggga ctcaacacaa
     4321 cagagagccg tgttggcagc agctctagaa atcatggtta aattctcccc agaaccacac
     4381 ttggctcaag tagtcgcgga ggaccttctt tctcctagcg tggtggacgt gggcgacttc
     4441 acaatatcaa tcaacgaggg ccttccctct ggggtgccct gcacctccca atggaactcc
     4501 atcgcccact ggcttctcac tctctgtgcg ctctctgaag tcacaaacct gtcccctgat
     4561 accatacagg ctaactccct cttctctttt tatggtgatg atgaaattgt tagcacagac
     4621 ataaaattgg acccagaaaa attgacagca aagctcagag aatatgggtt aaaaccaacc
     4681 cgccctgaca aaactgaagg accccttgtc atctctgaag acctgaatgg cctaactttc
     4741 ctgcggagaa ctgtgacccg cgacccagct ggttggtttg gaaaactgga gcagagttca
     4801 atactcaggc aaatgtactg gactaggggt cccaaccatg gagacccatc tgagacaatg
     4861 attccacact cccaaagacc catacaattg atgtccctac tgggggaggc cgctctccac
     4921 ggcccagcat tttacagcaa aatcagcaaa ttggtcattg cagagctaaa agaaggtggc
     4981 atggattttt acgtgcccag acaagagcca atgttcagat ggatgagatt ctcagatctg
     5041 agcacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgag
     5101 tgacgccaac ccatctgatg ggtccacagc caaccttgtc ccagaggtca acaatgaggt
     5161 tatggctttg gagcccgtag ttggtgccgc cattgcggca cctgtagcgg gccaacaaaa
     5221 tgtaattgac ccctggatta gaaacaattt tgtacaagcc cctggtggag agtttacagt
     5281 atcccctaga aacgctccag gtgaaatact atggagcgcg cccttaggcc ctgatttgaa
     5341 tccctacctt tcccatttgg ccaggatgta caatggttat gcaggtggtt ttgaagtgca
     5401 ggtaatcctc gcggggaacg cgttcaccgc cgggaaaatc atatttgcag cagtcccacc
     5461 aaatttccca actgaaggtt tgagccccag ccaggtcact atgttccccc acataatagt
     5521 agatgttagg caattggaac ctgtgttgat tcccttaccc gatgttagga ataatttcta
     5581 ccattataat caatcaaatg accccaccat caaattgata gcaatgttgt acacaccact
     5641 tagggctaat aatgccgggg acgatgtctt cacagtttct tgtcgagttc tcacgagacc
     5701 atcccccgat tttgatttca tatttttggt gccacccaca gttgaatcaa gaactaaacc
     5761 attctctgtc ccagttttaa ctgttgagga gatgaccaat tcaaggttcc ccattccttt
     5821 ggaaaagttg ttcacgggcc ccagtagtgc ctttgttgtt caaccacaaa acggcaggtg
     5881 cacgactgat ggcgtgctcc taggtactac ccaactgtct cccgtcaaca tctgcacctt
     5941 cagaggggat gtcacccata ttccaggcag tcgtaactac acaatgaatt tggcctccca
     6001 aaattggaac agttacgatc caacagaaga aatcccagcc cctctaggaa ctccagattt
     6061 cgtggggaag attcaaggtg tgctcaccca aaccacaagg acaaatggct cgacccgcgg
     6121 ccacaaagct acagtgtaca ctgggagcgc cgacttttct ccaaaactgg gtagagttca
     6181 atttgccact gacacagaca atgattttga aactaaccaa aacacaaagt tcaccccagt
     6241 cggtgttatc caggatggta gtaccacccc ccgaaatgaa ccccaacaat gggtgctccc
     6301 aagttattca ggcagaaaca ttcacaatgt gcacctggcc cccgctgtag cccccacttt
     6361 cccgggcgag cagctcctct tcttcagatc tactatgccc ggatgcagcg ggtaccccaa
     6421 catggacttg gactgtctgc tcccccagga atgggtgcag tatttctacc aggaggcagc
     6481 cccagcacaa tctgatgtgg ctctgctaag atttgtgaat ccggacacag gtagggtttt
     6541 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6601 tttggttatc ccccccaatg gttattttag atttgattcc tgggtcaacc agttctacac
     6661 acttgccccc atgggaaatg ggacggggcg tagacgtgca ttataatggc tggagctttc
     6721 tttgctggat tggcatctga cgtccttggc tctggacttg gttccctaat caatgctggg
     6781 gctggggcca tcaaccaaaa agttgaattt gaaaataaca gaaaattgca acaagcttcc
     6841 ttccaattta gtagcaatct acaacaggct tcctttcaac atgacaaaga gatgctccaa
     6901 gcacaaattg aggccaccaa aaagttgcaa caggaaatga tgagagttaa acaagcaatg
     6961 ctcctagagg gtggattctc tgagacagat gcagcccgtg gggcaatcaa cgcccccatg
     7021 acaaaaactt tggactggag cgggacaagg tactgggctc ccgatgctag gactacaaca
     7081 tataatgcag gccgcttttc caccccccaa ccctcggggg cactaccagg aagagctaat
     7141 cttagggcta ctgtccccgc ccggggttcc tccagcacgt cctctaactc ttctattgct
     7201 acttctgtgt attcaaatca aaccacctca acgagacttg gttctacagc tggttctggt
     7261 accagtgtct cgagcctccc gtcaactgca aggactagga gttgggttga ggatcaaaat
     7321 aggaatttgt cacctttcat gaggggggcc cataacatct cgtttgtcac cccaccatct
     7381 agcagatcct ctagccaagg cacagtctca accgtgccca aagaagtttt ggactcctgg
     7441 actggcgctt tcaacacgcg caggcagcct ctcttcgctc acattcgcaa gcgaggggag
     7501 tcacgggtgt aa
//