Typing tool

Complete norovirus genomes

AB933761  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,512 | 3 CDS

ORF1: 1..5103
ORF2: 5084..6706
ORF3: 6706..7512
LOCUS       AB933761                7512 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Osaka4/2011/JP genomic RNA, complete genome.
ACCESSION   AB933761
VERSION     AB933761.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Osaka4/2011/JP
  ORGANISM  Norovirus Hu/GII.4/Osaka4/2011/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7512)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7512
                     /organism="Norovirus Hu/GII.4/Osaka4/2011/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Osaka4/2011/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498755"
                     /country="Japan:Osaka"
                     /collection_date="2011"
     CDS             1..5103
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30343.1"
                     /translation="MKMASNDASAAAVANSNNDDAQSSSDGMLSSMAVTFKRALGARP
                     KQPPPREKPQRPPRPPTPELVKNIPPPPPNGKDEIGVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRESKDAKEPLTGTILEMGDGEIYHYGLYVERGLVLGVHKPPVAIS
                     LAKVELTPLSLYWRPVYTPQYLISPDTLKKLSGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLNVRRMIQRTTGFFRPYQDWNRKPLPTMDDSKIKKVANIFLCALSSLFTRPIKDIIG
                     KIRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLARE
                     VAKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADT
                     CPLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRT
                     MPELKQALKNVSIKKCQIVYSGCTYILESDGKGNVRVDRIQSAAVQTNNELAGALHHL
                     RCARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVENTEETTSKDG
                     CPKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERN
                     GKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGL
                     ITGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVS
                     PSLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPE
                     GTVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPG
                     DCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPIL
                     GPGSAPTLSTKTKFWRSSTASLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTE
                     PRGKPPKPSVLEAAKETIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDC
                     WNGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSD
                     LATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRW
                     DSTQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPC
                     TSQWNSIAHWLLTLCALSEITNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKL
                     REYGLKPTRPDKTEGPLVISGDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRG
                     PNHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQ
                     EPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5084..6706
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30344.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRINFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIPGSRNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTNGSTRGHKATVYTGSADFSPKLGRVQFATDTDNDFETNQNTKFTPVGVIQDG
                     STTPRNEPQQWVLPSYSGRNIHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6706..7512
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30345.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKTLDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRATVPARGSSSMSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacgac
       61 gcgcaatctt caagtgacgg aatgctctct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc tcccccgagg gaaaaaccac aaagaccccc acgaccacct
      181 actccagaac tggttaaaaa tattcccccc ccccccccca acggaaagga tgaaataggg
      241 gtttcttata gtgtcaaaga tggggtttcc ggtttgcctg acctttccac cgtcaggcaa
      301 ccggaagaat ctaacacggc cttcagtgtc cctccactca atcagaggga gagtaaagat
      361 gctaaggagc cacttactgg aacaattctg gaaatggggg acggggaaat ctaccattat
      421 ggcctgtatg tggagcgagg tcttgtacta ggggtgcaca aaccaccagt tgccatcagc
      481 ctcgctaagg ttgagctaac accactctcc ttgtactgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttatccggag aaacgttccc ctacacagcc
      601 tttgacaaca actgttatgc cttttgttgc tgggtcctgg acctaaatga ctcgtggctg
      661 aatgtcagga gaatgatcca gagaacaact ggtttcttca ggccctacca agactggaat
      721 aggaaacccc tccccactat ggatgactcc aaaataaaga aggtagctaa catattcctg
      781 tgtgctctgt cctcgctgtt caccagaccc ataaaagata taatagggaa gataaggcct
      841 cttaacatcc tcaacatctt agcctcatgt gattggactt ttgcaggcat agtggagtcc
      901 ctgatactct tggcagaact ctttggagtt ttctggacac ccccagatgt gtctgcgatg
      961 attgccccct tacttggtga ctatgagcta caaggacctg aggaccttgc agtggagctc
     1021 gtccccgtgg tgatgggggg aattggtttg gtgctaggat tcaccaaaga gaagattggg
     1081 aaaatgttgt catctgctgc gtccaccttg agagcttgta aagaccttgg tgcatatggg
     1141 ctagagatcc taaagttggt catgaagtgg ttcttcccga agaaggagga ggcaaatgag
     1201 ctggctatag tgaggtctat cgaggatgca gttctggatc tcgaggcaat tgaaaacaac
     1261 catatgacca ccttgcttaa agacaaagac agtctggcaa cctatatgag aacacttgac
     1321 cttgaggagg agaaagccag gaaactctca accaagtctg cctcacccga catcgtgggc
     1381 acaatcaacg ccctcctggc aagaatcgcc gccgcacgtt ctctggtgca tcgagcgaag
     1441 gaggagcttt ccagcagacc aagacctgtg gtgttgatga tatcaggcag gccaggaata
     1501 gggaagaccc acctcgctag ggaagtggct aagagaatcg cagcctcact tacaggagac
     1561 cagcgtgtgg gcctcatccc acgcaatggc gtcgaccatt gggatgcgta caagggggag
     1621 agggtcgtcc tatgggacga ttatggaatg agcaacccta ttcacgacgc cctcaggctg
     1681 caagaactcg ctgacacttg ccccctcact ctaaactgtg acaggattga aaataaagga
     1741 aaggtctttg acagcgatgt catcattatc accactaatc tggccaaccc agcaccactg
     1801 gactatgtca actttgaagc atgctcgagg cgcatcgact tcctcgtgta tgcggaagcc
     1861 cctgaagtcg aaaaggcgaa gcgtgacttc ccaggccagc ctgacatgtg gaagaacgct
     1921 ttcagttctg atttctcaca cataaaacta gcactggccc cacagggtgg tttcgacaag
     1981 aacgggaaca ccccacacgg aaagggcgtc atgaagactc tcaccactgg ctcccttatt
     2041 gcccgggcat cagggctact ccatgagagg ttagatgaat ttgaactaca gggcccagct
     2101 ctcaccacct tcaatttcga tcgcaataaa gtgcttgcct ttagacagct tgctgctgaa
     2161 aataaatatg gattgatgga cacaatgaga gttgggaaac agctcaagga tgtcagaacc
     2221 atgccagaac tcaaacaagc actcaagaat gtctcaatca agaagtgtca aatagtgtat
     2281 agtggttgca cctacatact tgagtctgat ggcaagggca atgtgagagt tgacagaatc
     2341 caaagcgccg ccgtgcagac caacaatgag ctggctggtg ccctgcacca tttgaggtgc
     2401 gccagaatca gatactatgt caagtgtgtc caggaggccc tgtattccat cattcaaatt
     2461 gctggggctg catttgtcac cacgcgcatt gccaagcgca tgaacataca agacctatgg
     2521 tccaagccac aagtggaaaa tacagaggag actaccagca aggacgggtg cccaaaacct
     2581 aaggatgatg aggagtttgt catttcatcc gacgacatca aaactgaggg taagaaaggg
     2641 aagaacaaga ctggccgcgg caagaagcac acagcatttt caagcaaagg cctcagtgat
     2701 gaagagtacg atgagtacaa gaggattaga gaagaaagga atggcaagta ctccatagaa
     2761 gagtaccttc aggacaggga caaatactat gaagaggtgg ccattgccag ggcgactgag
     2821 gaagacttct gtgaagagga ggaggccaag atccggcaaa ggatctttag gccaacaagg
     2881 aaacaacgca aggaggaaag agcctctctc ggtctgatca caggttctga aattaggaaa
     2941 agaaacccag atgacttcaa acccaaaggg aaattgtggg ctgacgatga caggagtgtg
     3001 gactacaatg agaaactcag ttttgaggcc ccaccaagca tctggtcgag aatagtcaac
     3061 tttggttcag gctggggatt ctgggtctcc cccagtctgt tcataacatc aacccatgtc
     3121 ataccccagg gcgcaaagga gttctttgga gtccccatca aacaaataca agtacacaag
     3181 tcaggcgagt tctgtcgctt gagattccca aaaccaatca ggactgatgt gacgggcatg
     3241 atcttagaag aaggcgcacc tgagggcacc gtggtcacac tactcatcaa aaggcccact
     3301 ggggaactca tgcccctagc agctaggatg gggacccatg cgaccatgaa gatccaaggg
     3361 cgcactgttg gaggccagat gggcatgctt ctgacaggat ccaacgccaa gagcatggac
     3421 ctgggtacta caccaggtga ttgtggctgc ccctacatct acaagagagg taatgactat
     3481 gtggtcattg gagtccacac ggctgccgca cgtgggggaa acactgtcat atgtgccacc
     3541 caggggagtg aaggagaggc tacacttgaa ggtggtgaca acaaggggac atactgtggt
     3601 gcaccaatcc taggcccagg gagtgcccca acacttagca ccaagaccaa attctggaga
     3661 tcgtccacag catcactccc acctggcacc tatgaaccag cctatcttgg tggtaaggat
     3721 cctagagtca agggtggccc ttcactgcag caagtcatga gggaacagtt gaagccattt
     3781 acagagccca ggggcaagcc accaaagcca agtgtattag aagctgctaa ggagaccatc
     3841 atcaatgtcc ttgagcaaac aattgatcca cctgagaaat ggtcgttcgc acaagcttgc
     3901 gcgtcccttg acaagaccac ttccagtggt cacccgcacc acatgcggaa aaacgactgc
     3961 tggaacgggg agtccttcac aggcaagctg gcagaccagg cttccaaggc caacctgatg
     4021 tttgaagaag ggaagaacat gaccccagtc tacacagctg cgctcaagga tgagttggtt
     4081 aaaactgaca aaatttatgg taagatcaag aaaaggcttc tctggggctc ggacttggcg
     4141 accatgatcc ggtgtgctcg agcattcgga ggcctaatgg atgaactcaa agcacactgt
     4201 gtcacacttc ccattagagt tggcatgaat atgaatgagg atggccccat catcttcgag
     4261 aggcattcca ggtacacata tcactatgat gctgattact ctcgatggga ttcaacacaa
     4321 cagagagccg tgttggcagc agctctagaa atcatggtta aattttcccc agaaccacat
     4381 ttggctcagg tagtcgcgga agaccttctt tctcctagcg tggtggacgt gggcgacttc
     4441 acaatatcaa tcaatgaggg tcttccctct ggggtgccct gcacctccca atggaactcc
     4501 atcgcccact ggcttctcac tctctgtgcg ctctctgaaa tcacaaacct gtcccctgat
     4561 accatacagg ctaactccct cttctctttt tatggtgatg atgaaattgt tagcacagat
     4621 ataaaattgg acccagagaa attgacagca aagctcagag aatatgggtt gaaaccaacc
     4681 cgccctgaca aaactgaagg accccttgtc atctctggag acctgaatgg cctaactttc
     4741 ctgcggagaa ctgtgacccg cgacccagct ggttggtttg gaaaactgga gcagagttca
     4801 atactcaggc aaatgtactg gactaggggt cccaaccatg gagacccttc tgaaacaatg
     4861 attccacact cccaaagacc catacaattg atgtccctac tgggggaggc cgctctccac
     4921 ggcccagcat tttacagcaa aatcagcaaa ttggtcattg cagagctaaa agaaggtggc
     4981 atggattttt acgtgcccag acaagagcca atgttcagat ggatgagatt ctcagatctg
     5041 agcacgtggg agggcgatcg caatctggct cccagttttg tgaatgaaga tggcgtcgag
     5101 tgacgccaac ccatctgatg ggtccacagc caacctcgtc ccagaggtca acaatgaggt
     5161 tatggctttg gagcccgtag ttggtgccgc cattgcggca cctgtagcgg gccaacaaaa
     5221 tgtaattgac ccctggatta gaatcaattt tgtacaagcc cctggtggag agtttacagt
     5281 atcccctaga aacgctccag gtgaaatctt atggagcgcg cccttaggcc ctgatttgaa
     5341 tccctacctt tctcatttgg ccagaatgta caatggttat gcaggtggtt ttgaagtgca
     5401 ggtaatcctc gcggggaacg cgttcaccgc cgggaaaatc atatttgcag cagtcccacc
     5461 aaatttccca actgaaggtt tgagccccag ccaggtcact atgttccccc atataatagt
     5521 agatgttagg caattggaac ctgtgttgat ccccttaccc gatgttagga ataatttcta
     5581 ccattataat caatcaaatg accccaccat caaattgata gcaatgttgt acacaccact
     5641 tagggctaat aatgccgggg atgatgtctt cacagtttct tgtcgagttc ttacgagacc
     5701 atcccccgat tttgatttca tatttttggt gccacccaca gttgaatcaa gaactaaacc
     5761 attctctgtc ccagttttaa ctgttgagga gatgaccaat tcaaggttcc ccattccttt
     5821 ggaaaagttg ttcacgggcc ccagtagtgc ctttgttgtt caaccacaaa acggcaggtg
     5881 cacgactgat ggcgtgctcc taggtactac ccaactgtct cctgtcaaca tctgcacctt
     5941 cagaggggat gtcacccata ttccaggcag tcgtaactac acaatgaatt tggcctccca
     6001 aaattggaac agttacgatc caacagaaga aatcccagcc cctctaggaa ctccagattt
     6061 cgtggggaag attcaaggtg tgctcaccca aaccacaagg acaaatggct cgacccgcgg
     6121 ccacaaagct acagtgtaca ctggaagcgc cgacttttct ccaaaactgg gtagagttca
     6181 atttgccact gacacagaca atgattttga aactaaccaa aacacaaagt tcaccccagt
     6241 cggtgttatc caggatggta gtactacccc ccgaaatgaa ccccaacaat gggtgctacc
     6301 aagttactca ggcagaaaca ttcataatgt gcacctggcc cccgctgtag cccccacttt
     6361 cccgggcgag cagctcctct tcttcagatc tactatgccc ggatgcagcg ggtaccccaa
     6421 catggatttg gactgtctgc tcccccagga atgggtgcag tacttctacc aggaggcagc
     6481 cccagcacaa tctgatgtgg ctctgttaag atttgtgaat ccagacacag gtagggtttt
     6541 gtttgagtgt aagcttcata aatcaggcta tgttacagtg gctcacactg gccaacatga
     6601 tttggttatc ccccccaatg gttattttag atttgattcc tgggtcaacc agttctacac
     6661 acttgccccc atgggaaatg ggacggggcg tagacgtgca ttataatggc tggagctttc
     6721 tttgctggat tggcatctga cgtccttggc tctggacttg gttccctaat caatgctggg
     6781 gctggggcca tcaaccaaaa agttgaattt gaaaataaca gaaaattgca acaagcttcc
     6841 ttccaattta gtagcaatct acaacaggct tcctttcaac atgacaaaga gatgctccaa
     6901 gcacaaattg aggccaccaa aaagttgcaa caggaaatga tgagagttaa acaagcaatg
     6961 ctcctagagg gtggattctc tgagacagat gcagcccgtg gggcaatcaa cgcccccatg
     7021 acaaaaactt tggactggag cgggacaagg tactgggctc ccgatgccag gactacaaca
     7081 tataatgcag gccgcttttc cacccctcaa ccctcggggg cattaccagg aagagctaat
     7141 cttagggcta ctgtccccgc ccggggttcc tccagcatgt cttctaactc ttctactgct
     7201 acttctgtgt attcaaatca aaccacctca acgagacttg gttctacagc tggttctggt
     7261 accagtgtct cgagcctccc gtcaactgca aggactagga gctgggttga ggatcaaaat
     7321 aggaatttgt cacctttcat gaggggggcc cacaacatct cgtttgtcac cccaccatct
     7381 agcagatcct ctagccaagg cacagtctca accgtgccca aagaagtttt ggactcctgg
     7441 actggcgctt tcaacacgcg taggcagcct ctcttcgctc acattcgcaa gcgaggggag
     7501 tcacgggtgt aa
//