Typing tool

Complete norovirus genomes

AB933759  GII.4 New Orleans
 GII.P4 Hunter

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933759                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Nagano26/2011/JP genomic RNA, complete genome.
ACCESSION   AB933759
VERSION     AB933759.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Nagano26/2011/JP
  ORGANISM  Norovirus Hu/GII.4/Nagano26/2011/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Nagano26/2011/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Nagano26/2011/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498753"
                     /country="Japan:Nagano"
                     /collection_date="2011"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30337.1"
                     /translation="MKMASNDASAAAVADSNNDTVKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKNIPPPPPNGEDDIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     FARVELTPLSLYWRPVYTPQYLISPDALKRLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGSTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQSLWSKPQVENTEETTSKDGC
                     QNPKDDEVFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHTRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLAISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAEPKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30338.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLATQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFATDTDNDFDANQNTKFTPVGVIQDG
                     DTAHRNEPQQWVLPSYSGRNSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30339.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGHFSIPQPSGALPGRANLRAAVPARGSSNTPS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARARSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctgatagcaa caacgacacc
       61 gtaaaatctt caagtgacgg agtgctttct agcatggctg tcactttcaa acgagccctc
      121 ggggcgcggc ctaaacagcc tcccccgagg gaaataccac aaagaccccc acgaccaccc
      181 actccagaac tgatcaaaaa tatcccccct cccccaccca acggagagga tgacatagtg
      241 gtttcttata gtgtcaaaga tggcgtctct ggtttgcctg atctttccac cgtcaggcaa
      301 ccggaagaat ctaatacggc cttcagtgtc cctccactca atcagaggga gaatagagat
      361 gctaaggaac cactgactgg aacaattttg gaaatgtggg atggagaaat ctatcattat
      421 ggcctgtatg tagagcgagg tcttgtgcta ggtgtgcaca aaccaccagc tgccatcagc
      481 ttcgctaggg tcgaactaac accactttcc ttgtactgga gacctgtgta tactccccag
      541 tacctcatct ctccagacgc tctcaagaga ctacacggag agacgttccc ctacacagct
      601 tttgacaaca actgctacgc cttttgttgt tgggtcctgg acctaaacga ctcgtggctg
      661 agtaggagaa tgatccagag aacaactggc ttcttcagac cctaccaaga ttggaatagg
      721 aaacccctcc ccactatgga tgactccaag ttaaagaagg tagctaacat attcctgtgt
      781 gcactgtctt cgctattcac caggcctata aaagatataa tagggaagct aaggcctctt
      841 aacatcctta acatcttggc ctcatgtgat tggacttttg caggcatagt ggagtccttg
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgacta cgagctacag ggacctgagg accttgcagt ggagctcgtc
     1021 cctgtagtga tggggggaat tggtttggtg ctaggattca ccaaagagaa gattggaaaa
     1081 atgttgtcat ctgctgcatc caccttgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttggttat gaagtggttc ttcccgaaga aagaggaagc aaatgaactg
     1201 gctatagtga gatccatcga ggatgcagtc ctggatctcg aagcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagacagt ctggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccaggaa actctcgacc aagtctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgctgct gcacgctctc tggtgcatcg agcgaaggag
     1441 gaactttcta gcagaccaag acctgtagtg ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgccaggga agtggctaag agaatcgcag cctcccttac aggagaccag
     1561 cgtgtaggcc tcgtcccacg caatggcgtc gaccattggg atgcgtacaa gggggagagg
     1621 gtcgttctat gggacgacta tggaatgagc aatcctatcc acgatgccct cagattgcaa
     1681 gaactcgctg acacttgtcc cctcacccta aactgtgaca ggattgagaa caaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcacc actaatttgg ctaacccagc accactggac
     1801 tatgtcaact tcgaagcatg ctcgaggcgc atcgacttcc tcgtgtatgc agaagcccct
     1861 gaggtcgaaa aggcgaagcg tgacttccca ggccaacccg acatgtggaa gaacgccttc
     1921 agttctgatt tctcacacat aaaactaaca ttggctccac agggtggttt cgacaagaac
     1981 gggaacaccc cacacgggaa gggcgtcatg aagactctca ccaccggctc ccttattgcc
     2041 cgggcatcag ggctactcca tgaaagacta gatgaatttg aactacaggg cccaactctc
     2101 accactttca actttgatcg caataaagtg cttgccttta gacaacttgc tgctgaaaat
     2161 aaatatgggt tgatggacac aatgaaagtt gggaggcagc tcaaggatgt cagaacaatg
     2221 ccagagctca agcaagcact caagaatatt tcaatcaaga agtgccaaat agtgtatagt
     2281 ggtagcacct acacacttga gtctgatggc aagggtaatg tgaaggttga cagagttcaa
     2341 agcgcctccg tgcagaccaa caatgagctg gctggcgccc tacaccatct aaggtgcgcc
     2401 agaataagat actatgtcag gtgtgtccag gaggccctgt attccatcat ccagattgct
     2461 ggggctgcat ttgtcaccac gcgcatcgtc aagcgcatga acatacaaag cctatggtct
     2521 aagccacaag tggaaaatac agaggagact accagcaagg acgggtgcca aaaccccaaa
     2581 gatgatgagg tgttcgtcat ttcatctgac gacatcaaaa ctgagggcaa gaaagggaaa
     2641 aacaagactg gccgcggtaa gaagcacaca gccttctcaa gcaaaggtct cagtgatgaa
     2701 gagtacgacg agtacaagag gattagagaa gaaaggaatg gtaagtactc catagaagag
     2761 taccttcagg acagggacaa atactatgag gaggtggcca ttgccagggc gactgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcaggcc aacaaggaaa
     2881 caacgcaagg aggaaagagc ttctctcggt ttagtcacag gttctgaaat taggaaaaga
     2941 aatccagatg atttcaaacc caaggggaaa ctgtgggctg acgatgacag aagtgtggac
     3001 tacaatgaga aactcagttt tgaagcccca ccaagcatct ggtcgaggat agtcaacttt
     3061 ggttcaggtt ggggattctg ggtctccccc agtttgttca taacatcaac ccatgtcata
     3121 ccccaaggag caaaggagtt ctttggagtc cccatcaaac aaattcaggt acataagtca
     3181 ggcgaattct gtcgcttgag attcccaaaa ccaatcagga ctgatgtgac gggcatgatc
     3241 ttagaagaag gtgcacccga gggaaccgtg gttacactac tcatcaaaag atccactggg
     3301 gagctcatgc ccctggcagc taggatgggg acccatgcaa ccatgaaaat ccaagggcgc
     3361 actgttggag gtcaaatggg catgcttctg acaggatcca acgccaaaag catggatctg
     3421 ggtaccacac caggtgattg tggctgtccc tacatctaca agagaggaaa tgactatgtg
     3481 gtcattggag tccacacggc tgccgctcgt gggggcaaca ctgtcatatg tgccacccag
     3541 gggagtgagg gagaggctac acttgaaggt ggtgacaata aagggacata ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca agaccaaatt ctggagatcg
     3661 tccacagcac cactcccacc tggcacctat gaaccagctt atcttggtgg taaggatccc
     3721 agagtcaagg gtgggccttc actacagcag gtcatgaggg atcagctgaa gccattcaca
     3781 gagcccaggg gcaagccacc aaagccaagt gtgttggaag ctgctaagaa aaccatcatc
     3841 aatgtccttg agcaaacaat tgatccacct gagaaatggt cgttcgcaca agcttgcgcg
     3901 tcccttgata agaccacctc cagtggccat ccgcatcaca cgcggaaaaa cgactgctgg
     3961 aacggggagt ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agaacatgac gccagtctac acagctgcgc ttaaggatga attagttaaa
     4081 actgacaaaa tttatggcaa gatcaagaag aggcttctct ggggctcgga tttggcgacc
     4141 atgatccggt gtgctcgagc attcggaggc ctaatggatg aactcaaagc gcactgtgtc
     4201 acacttccca ttagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagagg
     4261 cactccaggt acacgtacca ctatgatgct gattactctc gatgggattc aacacaacag
     4321 agagccgtgt tggcagcagc tctagaaatc atggttaagt tctccccaga accacatttg
     4381 gcccaggtag tcgcagaaga ccttctttct cctagcgtgg tggacgtggg tgatttcaca
     4441 atatcaatta acgagggcct tccttctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcaccct ctgtgcgctc tctgaagtta caaacttgtc tcctgacacc
     4561 atacaagcta actccctctt ctctttttat ggtgatgatg aaattgttag cacagacata
     4621 aaattggacc cagaaaagtt gacagcaaag ctcagggaat atgggttaaa accaacccgc
     4681 cccgacaaga ctgaaggacc ccttgccatc tctgaagact tgaatggcct gactttcttg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagttcaata
     4801 ctcaggcaaa tgtactggac taggggttcc aaccatgaag acccatttga aacaatgatt
     4861 ccacactccc aaagacccat acaattgatg tccctactgg gggaggccgc actccacggc
     4921 ccagcattct acagcaaaat cagcaagtta gtcattgcag aacctaaaga aggtggcatg
     4981 gatttttacg tgcccagaca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ctacagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgttg gtgccgccat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtatc
     5281 ccctaggaac gctccaggtg aaatactatg gagcgcgccc ctaggccctg atttgaatcc
     5341 ttacctttcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aatcctcgcg gggaacgcgt tcaccgccgg aaaaatcata tttgcagcag tcccaccaaa
     5461 tttcccaact gaaggcttga gccccagcca ggttactatg ttcccccaca taatagtaga
     5521 tgttaggcaa ctggaacctg tgttgatccc cttacccgat gttaggaata atttctatca
     5581 ctacaatcaa tcaaatgacc ccaccatcaa attgatagca atgttgtaca caccacttag
     5641 ggctaataat gctggggacg atgtcttcac agtttcttgt cgggtactca cgagaccatc
     5701 ccccgatttt gatttcatat ttttagtgcc acccacagtt gaatcaagaa ctaaaccatt
     5761 ctctgtccca attttaactg ttgaggagat gaccaattca agattcccca ttcctttgga
     5821 aaagctgttc acgggtccca gcagtgcctt tgttgttcaa ccacaaaacg gcaggtgcac
     5881 gactgatggc gtgctcctag gtaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccatatta caggtagtcg taactacaca atgaatttgg ctactcaaaa
     6001 ttggaacagt tatgacccaa cagaagaaat cccagcccct ctaggaactc cagatttcgt
     6061 gggaaagatc caaggtgtgc tcacccaaac cacgagggca gatggctcga cccgtggaca
     6121 caaagctaca gtgtacactg ggagcgccga ctttgctcca aaactgggta gagttcaatt
     6181 tgccactgac acagacaatg attttgatgc taaccaaaac acaaagttca ccccagtcgg
     6241 tgtcatccag gatggtgata ctgcccaccg aaatgaaccc caacaatggg tgctcccaag
     6301 ttactcaggt agaaatagtc acaatgtgca cctggccccc gctgtagccc ccacttttcc
     6361 gggtgagcaa cttctcttct tcagatccac tatgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctgctcc cccaggaatg ggtgcagtat ttctatcaag aggcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaatcca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataaat caggctatgt tacagtggct cacaccggcc aacatgatct
     6601 ggttatcccc cccaatggtt attttagatt tgattcctgg gtcaaccagt tctacacact
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcatta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggatcc gggcttggtt ctctgatcaa tgccggggct
     6781 ggggccatca accaaaaagt tgaatttgaa aataacagaa aattgcaaca agcttccttc
     6841 caattcagta gcaatctaca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccaccaaaaa gttgcaacag gaaatgatga gagttaaaca ggcaatgctc
     6961 ctagagggtg gattctctga gacagatgca gcccgtgggg caatcaacgc ccccatgaca
     7021 aaggctttgg actggagtgg gacaaggtac tgggctcccg atgctaggac tacaacatac
     7081 aatgcaggcc acttttccat ccctcaaccc tcgggggcac tgccagggag agctaatctt
     7141 agggctgctg tccccgctcg gggctcctcc aacacacctt ctaactcttc tactgctacc
     7201 tctgtgtact caaatcaaac cacttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 agtgtctcga gcctcccgtc aactgcaagg gctaggagct gggttgagga tcaaaatagg
     7321 aatttgtcac ctttcatgag gggggcccac aacatatcgt ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcccaaag aagttttgga ctcctggact
     7441 ggcgctttca atacgcgcag gcagcctctc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggcgtaa
//