Typing tool

Complete norovirus genomes

AB933758  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933758                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Chiba6/2011/JP genomic RNA, complete genome.
ACCESSION   AB933758
VERSION     AB933758.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Chiba6/2011/JP
  ORGANISM  Norovirus Hu/GII.4/Chiba6/2011/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Chiba6/2011/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Chiba6/2011/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498752"
                     /country="Japan:Chiba"
                     /collection_date="2011"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30334.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPDSLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFYRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     IRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYVLQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGKQLKDVRTM
                     PELKQALKNVSIKKCQIVYSGCTYILESDGKGCVKVDRIQSASVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEETTSKDGC
                     PKSKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERTSLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPTLSTKTKFWRSSAAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINALEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKSMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFAISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKVSKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30335.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSHNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSAEFSPKLGRVQFATDTNNDFDANQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30336.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGATN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQSSGALQGRANLRAAAPARGSPSTPS
                     NSSITTSVYSNQTTSTRLGSTAGSGTSVSSLPSAARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacgg agtgctttct agcatggctg tcactttcaa acgagccctc
      121 ggggcacggc ctaaacagcc tcccccgagg gaaataccac aaagaccccc acggccacct
      181 actccagaac tggttaaaaa tattccccct cccccgccca acggagagga tgaaatagta
      241 gtctcttata gtgtcaaaga tggtgtttcc ggtttgcctg acctttccac cgtcaggcaa
      301 ccggaagaat ctaacacggc cttcagtgtc cctccactca atcagaggga gaatagagat
      361 gctaaggaac cacttactgg aacaattctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctgtatg tggagcgagg tcttgtacta ggtgtgcaca aaccaccagc tgccatcagc
      481 ctcgctaggg ttgagctaac accactctcc ttgtactgga gacctgtgta cactcctcag
      541 tacctcatct ctccagactc tcttaagaaa ttacacggag aaacgttccc ctacacagcc
      601 tttgacaaca actgttatgc cttttgttgc tgggtcctgg acctaaatga ctcgtggctg
      661 agcaggagaa tgatccagag gacaactggt ttctacaggc cctaccaaga ctggaatagg
      721 aaaccccttc ccaccatgga tgattccaaa ttaaagaagg tagctaatat attcctgtgt
      781 gccctgtcct cgctgttcac cagacccata aaggatataa tagggaagat aaggcctctc
      841 aacatcctca acatcttagc ctcatgtgat tggacttttg caggcatagt ggagtccctg
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgacta cgtgctacaa ggacctgagg accttgcagt ggagctcgtc
     1021 cccgtggtga tggggggaat tggtttggtg ctaggattca ccaaagagaa gattgggaaa
     1081 atgttgtcat ctgctgcgtc caccctgaga gcttgtaaag accttggtgc atatgggcta
     1141 gagatcctaa agttggtcat gaagtggttc ttcccgaaga aggaggaagc aaatgagctg
     1201 gctatagtga ggtctatcga ggatgcagtc ctggatctcg aggcaattga aaacaaccat
     1261 atgaccgcct tgctcaaaga caaagacagt ctggcaacct acatgagaac acttgacctt
     1321 gaggaggaga aagccaggaa actctcaacc aagtctgcct cacctgacat cgtgggtaca
     1381 atcaacgccc tcctggcgag aatcgctgcc gcacgttctc tagtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag gcctgtggtg ttgatgatat caggcagacc agggataggg
     1501 aagacccacc tcgctaggga agtggctaag aggatcgcag cctccctcac aggagaccag
     1561 cgtgtgggcc tcatcccacg caatggcgtc gaccattggg atgcgtacaa gggggagagg
     1621 gtcgtcctgt gggacgatta tggaatgagc aaccctattc acgatgccct caggctgcaa
     1681 gaactcgctg acacttgccc cctcactcta aactgtgaca ggattgagaa taaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcacc actaatctgg ccaacccagc accactggac
     1801 tatgtcaact ttgaagcatg ctcgaggcgc atcgacttcc tcgtgtatgc agaggcccct
     1861 gaagtcgaaa aggcgaagcg tgacttccca ggccagcctg acatgtggaa gaacgccttc
     1921 agttctgact tctcacacat aaaactagca ctggccccac agggtggttt cgacaagaac
     1981 gggaacaccc cacacggaaa gggcgtcatg aagactctca ccactggctc ccttattgcc
     2041 cgggcatcag ggctgctcca tgagaggtta gatgaatttg aactacaagg cccagctctc
     2101 accaccttca acttcgatcg caataaagtg cttgccttta gacaacttgc tgctgaaaat
     2161 aaatatggat tgatggacac aatgaaggtt gggaaacaac tcaaggatgt caggaccatg
     2221 ccagaactca aacaagcact caagaatgtc tcaatcaaga agtgccaaat agtgtatagt
     2281 ggttgcacct atatacttga gtctgatggc aagggctgtg tgaaagttga tagaatccaa
     2341 agcgcctccg tgcagaccaa caatgagctg gctggtgccc tgcaccattt gaggtgcgcc
     2401 aggatcagat actatgtcaa gtgtgtccag gaggccctgt attccatcat tcaaattgct
     2461 ggggctgcat ttgtcaccac gcgcatcgtc aagcgcatga acatacaaga cctatggtcc
     2521 aagccacaag tggaaaacac agaggagacc accagcaagg acgggtgccc aaagtccaag
     2581 gatgatgagg agtttgtcat ttcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagactg gccgcggcaa gaagcacaca gccttttcaa gcaaaggcct cagtgatgaa
     2701 gagtacgatg agtacaagag gattagagaa gaaaggaatg gcaagtactc catagaagag
     2761 taccttcagg acagggacaa atactatgag gaggtggcca ttgccagggc gactgaggaa
     2821 gacttctgtg aagaggagga ggccaagatt cggcaaagga tctttaggcc aacaaggaaa
     2881 caacgcaagg aggaaagaac ttctctcggc ctggttacag gctctgaaat taggaaaaga
     2941 aacccagatg acttcaaacc taaagggaaa ttgtgggctg acgatgacag aagtgtggac
     3001 tacaatgaga aactcagctt tgaggctcca ccaagcatct ggtcgagaat agtcaacttc
     3061 ggttcaggct ggggattctg ggtctccccc agtctgttta taacatcaac ccatgtcata
     3121 ccccaaggcg caaaggagtt ctttggagtc cccatcaaac aaatacaggt acacaagtca
     3181 ggcgagttct gtcgcttgag attcccaaaa ccaatcagga ctgatgtgac gggcatgatc
     3241 ttagaagaag gcgcacctga gggcaccgtg gtcacactac tcatcaaaag gtccactggg
     3301 gaactcatgc ccctagcagc taggatgggg acccatgcaa ccatgaagat ccaagggcgc
     3361 actgttggag gccagatggg catgcttctg acagggtcca acgccaagag catggacctg
     3421 ggtactacac caggtgattg tggctgcccc tacatctaca agagaggtaa cgactatgtg
     3481 gtcattggag tccacacggc tgccgcacgt ggggggaaca ctgtcatatg tgccacccag
     3541 gggagtgaag gagaggctac acttgaagga ggtgacaaca aggggacgta ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaca cttagcacca agaccaaatt ctggaggtcg
     3661 tccgcagcac cgctcccacc tggcacttat gaaccagcct atcttggtgg caaggaccct
     3721 agagtcaagg gtggcccttc attgcagcaa gtcatgaggg aacagttgaa gccattcaca
     3781 gagcccaggg gcaaaccacc gaagccaagt gtattagaag ctgccaagaa gaccatcatt
     3841 aatgcccttg agcaaacaat tgacccacct gagaaatggt cattcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc cagtggtcat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggagt ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agagtatgac cccagtctac acagctgcgc tcaaggatga gttagttaaa
     4081 actgacaaaa tttatggtaa gatcaagaag agacttctct ggggctcgga cctggcgacc
     4141 atgatccgat gtgctcgagc attcggaggc ctaatggatg agctcaaagc acactgtgtc
     4201 acacttccca ttagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagagg
     4261 cattccaggt acacatatca ctatgatgct gactactctc gatgggattc aacacaacag
     4321 agagccgtgt tggcagcagc tctagaaatc atggttaaat tctccccaga accacatttg
     4381 gctcaggtag tcgcggaaga ccttctttct cctagcgtgg tggacgtggg cgacttcgca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaattccatc
     4501 gcccactggc ttctcactct ctgtgcgcta tctgaagtca caaacttgtc ccctgatacc
     4561 atacaggcca actccctctt ctctttttat ggtgatgatg aaatcgttag cacagatata
     4621 aaattggacc cagagaaatt gacagcaaag ctcagggaat atgggttaaa accaacccgc
     4681 cctgacaaaa ctgaaggacc ccttgtcatc tctgaagact tgaatggcct aactttcctg
     4741 cggagaactg tgacccgtga cccagctggt tggtttggaa aactggagca gagttcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatggag acccatctga gacaatgatt
     4861 ccacactccc aaagacccat acaattgatg tccctactgg gggaggccgc tctccacggc
     4921 ccagcgtttt acagcaaggt cagcaaattg gtcattgcag agctaaaaga aggaggcatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ccacagccaa cctcgtccca gaggtcaata atgaggttat
     5161 ggctttggag cccgttgttg gtgccgccat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataactttgt acaagcccct ggtggagagt ttacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atttgaatcc
     5341 ctacctttcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aatcctcgcg gggaacgcgt tcaccgccgg gaaaatcata tttgcagcag tcccaccaaa
     5461 tttcccaact gaaggtttga gccccagcca agtcaccatg ttcccccaca taatagtaga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacccgac gttaggaata atttctacca
     5581 ttataatcaa tcaaatgacc ccaccatcaa attgatagca atgttgtata caccacttag
     5641 ggctaataat gctggggacg atgtcttcac agtttcttgt cgagttctca cgagaccatc
     5701 ccccgatttt gatttcatat ttctagtgcc acccacagtt gaatcaagaa ctaaaccatt
     5761 ctctgtccca attctaactg ttgaggagat gaccaattca aggttcccca ttcctttgga
     5821 aaagttgttc acgggcccca gtagtgcctt tgttgttcaa ccacaaaacg gcaggtgcac
     5881 gactgatggc gtcctcctag gtactaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccacattg caggcagtca taactacaca atgaatctgg cttcccaaaa
     6001 ttggaacagt tatgacccaa cagaagaaat cccagcccct ctaggaactc cagatttcgt
     6061 ggggaagatt caaggtgtac tcacccaaac cacaaggacg gatggctcca cccgcggcca
     6121 caaagccaca gtgtacactg ggagcgccga attttcccca aaactgggta gagttcaatt
     6181 tgccactgac acaaacaatg attttgatgc taaccaaaac acaaagttta ccccagtcgg
     6241 tgttatccag gatggtggta ctacccaccg aaatgaaccc caacaatggg tgcttccaag
     6301 ttactcaggc agaaatactc ataatgtgca cctggccccc gctgtagctc ccacttttcc
     6361 gggtgagcag ctcctcttct tcagatctac catgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctgctcc cccaggaatg ggtgcagtat ttctaccagg aggcagcccc
     6481 agcacaatct gatgtggctc tgctgagatt tgtgaaccca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataagt cgggctatgt tacagtggct cacactggcc aacatgattt
     6601 ggttatcccc cccaatggtt attttagatt tgattcctgg gtcaatcagt tctacacact
     6661 tgcccccatg ggaaacggga cggggcgtag acgtgcatta taatggctgg agctttcttt
     6721 gctggattgg catctgacgt ccttggctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgaatttgaa aataacagaa aattgcaaca agcttccttc
     6841 caatttagta gcaatctaca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccaccaaaaa gttgcaacag gagatgatga gagtcaaaca agcaatgctc
     6961 ctagagggtg gattctctga gacagatgca gcccgtgggg caaccaacgc ccccatgaca
     7021 aaagctttgg actggagcgg gacaaggtat tgggctcccg atgctaggac tacaacatat
     7081 aatgcaggcc gcttttccac cccacaatcc tcgggggcat tacaaggaag agctaatctt
     7141 agggctgctg cccccgcccg gggttcccct agtacacctt ctaactcttc tattactact
     7201 tctgtgtatt caaatcaaac cacttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 agtgtctcga gcctcccgtc agctgcaagg actaggagct gggttgagga tcaaaatagg
     7321 aatttgtcac ctttcatgag gggggcccac aacatctcgt ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcccaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcccctc ttcgctcaca tccgtaagcg aggggagtca
     7501 cgggtgtaa
//