Typing tool

Complete norovirus genomes

AB933757  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933757                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Saga4/2009/JP genomic RNA, complete genome.
ACCESSION   AB933757
VERSION     AB933757.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Saga4/2009/JP
  ORGANISM  Norovirus Hu/GII.4/Saga4/2009/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Saga4/2009/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Saga4/2009/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498751"
                     /country="Japan:Saga"
                     /collection_date="2009"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30331.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPRETPQRPPRPPTPELVKNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPDSLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     IKPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYVLQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRTM
                     PELKQALKNVSIKKCQIVYSGCTYILESDGKGSVKVDRIQSASVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEETTSKDGC
                     PKSKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPTLSTKTKFWRSSTAPLPPGTFEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINALEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKSMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFAISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30332.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFSAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPTPLEKLFTGPSSTFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSHNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSAEFSPKLGRVQVATDTNNDFDANQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNAHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30333.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQSSGALPGRANLRAAVPARGSSSISS
                     NSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacgg agtgctttct agcatggctg tcacttttaa acgagccctc
      121 ggggcacggc ctaaacagcc tcccccgagg gaaacaccac aaagaccccc acgaccacct
      181 actccagaac tggttaaaaa tattccccct cccccgccca acggagagga tgaaatagtg
      241 gtctcttata gtgtcaaaga tggtgtttcc ggtttgcctg acctttccac cgtcaggcaa
      301 ccggaagaat ctaacacggc cttcagtgtc cctccactca atcagaggga gaatagagat
      361 gctaaggagc cacttactgg aacaattctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctgtatg tggagcgagg tcttgtacta ggtgtgcaca agccaccagc tgccatcagc
      481 ctcgctaggg tagagctaac accactctcc ttgtactgga gacctgtgta cactcctcag
      541 tacctcatct ctccagactc tctcaagaaa ttacacggag aaacgttccc ctacacagcc
      601 tttgacaaca actgttatgc cttttgttgc tgggtcctgg acctaaatga ctcgtggctg
      661 agcaggagaa tgatccagag gacaactggt ttcttcaggc cctaccaaga ctggaatagg
      721 aaaccccttc ccactatgga tgattccaaa ttaaagaagg tagccaatat attcctgtgt
      781 gctctgtcct cgctgttcac cagacccata aaggatataa tagggaagat aaagcctctt
      841 aacatcctca acatcttagc ctcatgtgat tggacttttg caggcatagt ggagtccctg
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgacta cgtgctacaa ggacccgagg accttgcagt ggagctcgtc
     1021 cccgtggtga tggggggaat tggtttggtg ctaggattca ccaaagagaa gattgggaaa
     1081 atgctgtcat ctgctgcgtc caccctgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttggtcat gaagtggttc ttcccgaaga aggaggaagc aaatgagctg
     1201 gctatagtga ggtctatcga ggatgcagtc ctggatctcg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagacagt ctggcaacct atatgagaac acttgacctt
     1321 gaggaggaga aagccaggaa actctcaacc aagtctgcct cacctgacat cgtgggcaca
     1381 atcaacgccc tcctggcgag aatcgctgcc gcacgttctc tggtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag acctgtggtg ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc tcgctaggga agtggctaag aggatcgcag cctcccttac aggagaccag
     1561 cgtgtgggcc tcatcccacg caatggcgtc gaccattggg atgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgatta tggaatgagc aaccctattc acgatgccct caggctgcaa
     1681 gaactcgctg atacttgccc cctcactcta aactgtgaca ggattgagaa taaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcacc actaatctgg ccaacccagc accactggac
     1801 tatgtcaact ttgaagcatg ctcgaggcgc atcgacttcc tcgtgtatgc agaagcccct
     1861 gaagtcgaaa aggcgaagcg tgacttccca ggccagcctg acatgtggaa gaacgccttc
     1921 agttctgatt tctcacacat aaaacttgca ctggccccac agggtggttt cgacaagaac
     1981 gggaacaccc cacacggaaa gggcgtcatg aagactctca ccactggctc ccttattgcc
     2041 cgggcatcag ggctgctcca tgagaggtta gatgaatttg aactacaggg cccagctctc
     2101 accaccttca attttgatcg caataaagtg cttgccttta gacaacttgc tgctgaaaat
     2161 aagtatggat tgatggacac aatgagagtt gggaaacaac tcaaggatgt cagaaccatg
     2221 ccagaactca aacaagcact caagaatgtc tcaatcaaga agtgccaaat agtgtatagt
     2281 ggttgcacct acatacttga gtctgatggc aagggcagtg tgaaagttga cagaatccaa
     2341 agcgcctccg tgcagaccaa caatgagctg gctggtgccc tgcaccattt gaggtgcgcc
     2401 agaatcagat actatgtcaa gtgtgtccag gaggccctgt attccatcat tcaaattgct
     2461 ggggctgcat ttgttaccac gcgcatcgtc aagcgcatga acatacaaga cctatggtcc
     2521 aagccacaag tggaaaacac agaggagacc accagcaagg acgggtgccc aaaatccaag
     2581 gatgatgagg agtttgtcat ttcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagactg gccgcggcaa gaagcacaca gccttttcaa gcaaaggcct cagtgatgaa
     2701 gagtacgatg agtacaagag gattagagaa gaaaggaatg gcaagtactc tatagaagag
     2761 taccttcagg acagggacaa atactatgag gaggtggcca ttgccagggc gactgaggaa
     2821 gacttctgtg aagaggagga ggccaagatt cggcaaagga tctttaggcc aacaaggaaa
     2881 caacgcaagg aggaaagagc ttctctcggt ctggtcacag gctctgaaat taggaaaaga
     2941 aacccagatg acttcaaacc caaggggaaa ttgtgggctg acgatgacag aagtgtggac
     3001 tacaatgaga aactcagttt tgaggcccca ccaagcatct ggtcgagaat agtcaacttt
     3061 ggttcaggct ggggattctg ggtctccccc agtctgttca taacatcaac ccatgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaatacaggt acacaagtca
     3181 ggcgagttct gtcgcttgag attcccaaaa ccaatcagga ctgatgtgac gggcatgatc
     3241 ttggaagaag gcgcacctga gggcaccgtg gtcacactac tcatcaaaag gtccactggg
     3301 gaactcatgc ccctagcagc taggatgggg acccatgcaa ccatgaagat ccaagggcgc
     3361 actgttggag gccagatggg catgcttctg acagggtcca acgccaagag catggacctg
     3421 ggtactacac caggtgactg tggctgcccc tatatctaca agagaggtaa tgactatgtg
     3481 gtcattggag tccacacggc tgccgcacgt gggggaaaca ctgtcatatg tgccacccag
     3541 gggagtgaag gagaggctac acttgaagga ggtgacaaca aggggacata ctgtggagca
     3601 ccaatcctag gcccagggag tgccccaaca cttagcacca agaccaagtt ctggaggtcg
     3661 tccacagcac cgctcccacc tggcaccttt gaaccagcct atcttggtgg caaggaccct
     3721 agagtcaagg gtggcccttc actgcagcaa gtcatgaggg aacagttgaa gccattcaca
     3781 gagcccaggg gcaaaccacc aaagccaagt gtattagaag ctgccaagaa gaccatcatc
     3841 aatgcccttg agcaaacaat tgatccacct gagaaatggt cattcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc cagtggtcat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggagt ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agagcatgac cccagtctac acagctgcgc tcaaggatga gttagttaaa
     4081 actgacaaaa tttatggtaa aatcaagaag agacttctct ggggctcgga cttggcgacc
     4141 atgatccgat gtgctcgagc attcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acacttccca ttagagttgg tatgaatatg aatgaggatg gccccatcat cttcgaaaag
     4261 cattccaggt acacatatca ctatgatgct gattactctc gatgggattc gacacaacag
     4321 agagccgtgt tggcagcagc tctagaaatc atggttaaat tctccccaga accacatctg
     4381 gctcaggtag tcgcggaaga ccttctttct cctagtgtgg tggacgtggg cgacttcgca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaattccatc
     4501 gcccactggc ttctcactct ctgtgcgctc tctgaagtca ccaacttgtc ccctgatacc
     4561 atacaggcca actccctctt ctctttttat ggtgatgatg aaatcgttag cacagacata
     4621 aaattggacc cagagaaatt gacagcaaag ctcagggaat atgggttaaa accaacccgc
     4681 cctgacaaaa ctgaaggacc ccttgtcatc tctgaagact tgaatggcct aactttcctg
     4741 cggagaactg tgacccgtga cccagctggt tggtttggaa aactggagca gagttcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatggag acccatctga aacaatgatt
     4861 ccacactccc aaagacccat acaattgatg tccctactgg gggaggccgc actccacggc
     4921 ccagcatttt acagcaagat cagcaagttg gtcattgcag agctaaaaga aggtggcatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ccacagccaa cctcgtccca gaggtcaata atgaggttat
     5161 ggctttggag cccgttgttg gtgccgccat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa acaactttgt acaagcccct ggtggagagt ttacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atttgaatcc
     5341 ctacctttcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aatcctcgcg gggaacgcgt tcaccgccgg gaaaatcata ttttcagcag tcccaccaaa
     5461 tttcccaact gaaggtttga gccccagcca ggtcactatg ttcccccaca taatagtaga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacccgat gttaggaata atttctacca
     5581 ttataatcaa tcaaatgacc ccaccataaa attgatagcg atgttgtata caccacttag
     5641 ggctaataat gctggggacg atgtcttcac agtttcttgt cgagttctca cgagaccatc
     5701 ccccgatttt gatttcatat ttctagtgcc acccacagtt gaatcaagaa ctaaaccatt
     5761 ctctgtccca attctaactg ttgaggagat gaccaattca aggttcccca ctcctttgga
     5821 aaagctgttc acgggcccca gtagtacctt tgttgttcaa ccacaaaacg gcaggtgcac
     5881 gactgatggc gtgctcctag gtaccaccca actgtctcct gtcaacatct gcactttcag
     5941 aggggatgtc acccatatta caggcagtca taactataca atgaatctgg cttcccaaaa
     6001 ttggaacagt tatgacccaa cagaagagat cccagcccct ctagggactc cagatttcgt
     6061 ggggaagatt caaggcgtgc tcacccaaac cacaaggacg gatggctcga cccgcggcca
     6121 caaagctaca gtgtacactg ggagcgccga attttcccca aaactgggta gagttcaagt
     6181 tgccactgac acaaacaatg attttgatgc caaccaaaac acaaagttca ccccagtcgg
     6241 tgttatccag gatggtggta ctacccaccg aaatgaaccc caacaatggg tgcttccaag
     6301 ttactcaggc agaaatgctc acaatgtgca cctggccccc gctgtagccc ccacttttcc
     6361 gggtgagcag ctcctctttt tcaggtctac catgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctactcc cccaggaatg ggtgcagcat ttctaccagg aggcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaaccca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataaat caggctatgt tacagtggct cacactggcc aacatgattt
     6601 ggttatcccc cccaatggtt attttagatt tgattcctgg gtcaaccagt tctacacact
     6661 tgcccccatg ggaaatggga cggggcgtag acgtgcatta taatggctgg agctttcttt
     6721 gctggattgg catctgacgt ccttggctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgaatttgaa aataacagaa aattgcaaca agcttccttc
     6841 caatttagta gcaatctaca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccaccaaaaa gttgcaacag gaaatgatga gagttaaaca agcaatgctc
     6961 ctagagggtg gattctctga gacagatgca gcccgtgggg caatcaacgc ccccatgaca
     7021 aaagctttgg actggagcgg gacaaggtat tgggctcccg atgctaggac tacaacatat
     7081 aatgcaggcc gcttttccac ccctcaatcc tcgggggcac taccaggaag agctaatctt
     7141 agggctgctg tccccgcccg gggttcctct agcatatctt ctaactcttc tattgctact
     7201 tctgtgtact caaatcaaac cacttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 agtgtctcga gcctcccgtc aactgcaagg actaggagct gggttgagga tcaaaatagg
     7321 aatttgtcac ctttcatgag gggggcccac aacatctcgt ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcccaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca tccgtaagcg aggggagtca
     7501 cgggtgtaa
//