Typing tool

Complete norovirus genomes

AB933738  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,509 | 3 CDS

ORF1: 1..5097
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933738                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Niigata5/2009/JP genomic RNA, complete genome.
ACCESSION   AB933738
VERSION     AB933738.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Niigata5/2009/JP
  ORGANISM  Norovirus Hu/GII.4/Niigata5/2009/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Niigata5/2009/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Niigata5/2009/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498732"
                     /country="Japan:Niigata"
                     /collection_date="2009"
     CDS             1..5097
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30274.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPRETPQRPPRPPTPELVKKIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGAILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPDSLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKIANIFLCALSSLFTRPIKDIIGK
                     IRPLNILNILASCDWTFAGIVESLILLAELFGIFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLIMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHEALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRTM
                     PELKQALKNVSIKKCQIVYSGCTYILESDGKGNVKVDRIQSASVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVENTEETTNKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAILEGGDNKGTYCGAPILG
                     PGSAPTLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHTRKNDCW
                     NGESFTGKLADQASKANLMFEEGKSMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKLSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTTKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHGDPSETMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGV"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30275.1"
                     /translation="MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLFPLARKVKGYAGG
                     FEVQVILAGKAFPAGKIIFAASPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSTFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRRDGSTRGHKATVYTGSADFSPKLGRVQFATDTDNDFDTHQNTKFTPVGVIQDG
                     GTAHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30276.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSSLQQASFQHDKEMLQAQIEATKKLQQEMVRVKQAMLLEGGFSETDAARGAIN
                     APMTKVLDWSGTRYWVPDARTTTYNAGRFSTPQPLGALPGRANLGTAVPAQGSSSTSS
                     NSSIATSVYSNQTISTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacgg agtgctttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc ccccccgagg gaaacaccac aaagaccccc acgaccacct
      181 actccagaac tggtcaaaaa gatccccccc cccccgccca acggagagga tgaaatagtg
      241 gtttcttata gtgtcaaaga tggtgtttcc ggtttgcctg atctttccac cgtcaggcaa
      301 ccggaagaat ccaacacggc tttcagtgtc cctccactca atcagaggga gaatagagat
      361 gctaaggaac cactcactgg agcaattctg gaaatgtggg atggggaaat ctaccattat
      421 ggcctgtatg ttgagcgagg tcttgtacta ggtgtgcaca aaccaccagc cgccatcagc
      481 ctcgccaggg ttgagctaac accactctcc ttgtactgga gacctgtgta cactcctcag
      541 tacctcatct ctccagactc tctcaagaaa ttacacggag aaacatttcc ctacacagcc
      601 tttgacaaca attgttatgc cttctgttgc tgggtcctgg atctaaatga ctcgtggctg
      661 agcaggagaa tgatccagag aacaactggt ttcttcagac cctaccaaga ctggaatagg
      721 aaacccctcc ccactatgga tgactccaaa ttaaagaaga tagctaacat attcctgtgt
      781 gctctgtcct cgctgttcac cagacccata aaagatataa tagggaagat aaggcctctt
      841 aacatcctca acatcttagc ttcatgtgac tggacttttg caggcatagt ggagtccctg
      901 atactcttgg cagaactctt tggaattttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgacta cgagttacaa ggacctgagg accttgcagt ggagctcgtc
     1021 cctgtggtga tggggggaat tggtttggta ctaggattca ccaaagagaa gattggaaaa
     1081 atgttgtcat ctgctgcgtc caccttgaga gcttgtaaag accttggtgc atatgggcta
     1141 gagatcctaa agttgatcat gaagtggttc ttcccgaaga aggaggaagc aaatgaactg
     1201 gctatagtga ggtctatcga ggatgcagtc ctggatcttg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagacagt ctggcaacct acatgagaac ccttgacctt
     1321 gaggaagaaa aggccaggaa actttcaacc aagtctgcct cacctgacat cgtgggcaca
     1381 atcaacgccc tcctggcgag aatcgctgcc gcacgttctc tggtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag acctgtggtg ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc tcgctaggga agtggctaag agaatcgcag cctcccttac aggagaccag
     1561 cgtgtgggcc tcatcccacg caatggcgtc gatcattggg acgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgatta tggaatgagc aatcctatcc acgaagccct caggctgcaa
     1681 gaacttgctg acacttgccc cctcactcta aactgtgaca ggattgagaa taaaggaaag
     1741 gtctttgaca gcgatgtcat catcatcacc actaatctgg ccaacccagc accactggac
     1801 tatgtcaact ttgaagcatg ctcgaggcgc atcgacttcc tcgtgtatgc agaagcccct
     1861 gaagtcgaaa aggcgaagcg tgacttccca ggccagcctg acatgtggaa aaacgccttc
     1921 agttctgatt tctcacacat aaaactagca ctggcccctc agggtggttt cgacaagaac
     1981 gggaacaccc cgcacggaaa gggcgtcatg aagactctca ctactggctc ccttattgcc
     2041 cgggcatcag ggctactcca tgagaggtta gatgaatttg aattacaggg cccagctctc
     2101 accaccttca atttcgaccg caataaagtg cttgccttta gacaacttgc tgctgaaaat
     2161 aaatatggat tgatggacac aatgagagtt gggaaacagc tcaaggatgt tagaaccatg
     2221 ccagaactca aacaagcact caagaatgtc tcaatcaaga agtgccaaat agtgtatagt
     2281 ggttgcacct acatacttga gtctgacggc aagggtaatg tgaaggttga cagaatccaa
     2341 agcgcctccg tgcagaccaa caatgagctg gctggtgccc tgcaccattt gaggtgcgcc
     2401 agaatcagat actatgtcaa gtgtgtccag gaggccctgt attccatcat tcaaattgct
     2461 ggggctgcat ttgtcaccac gcgcatcgcc aagcgcatga acatacaaga cctatggtcc
     2521 aagccacaag tggaaaacac agaggagacc accaacaagg acgggtgccc aaaacccaag
     2581 gatgatgagg agtttgtcat ttcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagactg gccgcggcaa gaagcacaca gccttttcaa gcaaaggcct cagtgatgaa
     2701 gagtacgatg agtacaagag gattagagaa gaaaggaatg gcaagtactc catagaagag
     2761 tacctccagg acagggacaa atactatgag gaggtggcca ttgccagggc gactgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tctttaggcc aacaaggaaa
     2881 caacgcaagg aggaaagagc ttctctcggt ctggtcacag gctctgaaat taggaaaaga
     2941 aacccagacg acttcaaacc caagggtaaa ttgtgggctg acgatgacag aagtgtggac
     3001 tacaatgaga aactcagttt tgaggcccca ccaagcatct ggtcgagaat agtcaatttt
     3061 ggttcaggct ggggattctg ggtctccccc agtctgttca taacatcaac ccatgtcata
     3121 ccccagggtg caaaggagtt ctttggagtc cccatcaaac aaattcaggt tcacaagtca
     3181 ggcgagttct gtcgcttgag gttcccaaaa ccaatcagga ctgatgtgac gggcatgatc
     3241 ttggaagaag gcgcacctga gggcaccgtg gtcacactac tcatcaaaag gtccaccggg
     3301 gaactcatgc ccctagcagc taggatgggg acccatgcaa ccatgaagat ccaagggcgc
     3361 actgttggag gccagatggg catgcttctg acaggatcca atgccaagag catggacctg
     3421 ggtaccacac caggtgattg tggctgtccc tatatctaca agagaggaaa tgactatgtg
     3481 gtcattggag tccacacggc tgccgcacgt gggggaaaca ctgtcatatg tgccacccag
     3541 gggagtgaag gggaggctat acttgaaggt ggtgacaaca aggggacata ctgtggtgca
     3601 ccaatcctgg gcccagggag tgccccaacc cttagcacca agaccaaatt ctggaggtcg
     3661 tctacggcac cgctcccacc tggcacctat gaaccagcct atcttggtgg caaagaccct
     3721 agagtcaagg gtggcccttc actgcagcaa gtcatgaggg aacagttgaa gccattcaca
     3781 gagccaaggg gcaaaccacc aaagccaagt gtattagagg ctgccaagaa gaccatcatc
     3841 aatgtccttg agcaaacaat tgatccacct gagaaatggt cattcgcgca agcttgcgcg
     3901 tccctcgaca agaccacttc cagtggtcat ccgcaccaca cgcggaaaaa cgactgctgg
     3961 aacggggagt ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agagcatgac cccagtctac acagctgcgc tcaaggatga gttagttaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcaga tttggcaacc
     4141 atgatccggt gtgctcgagc gttcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acacttccca ttagggttgg tatgaatatg aatgaggatg gccccatcat cttcgagagg
     4261 cattccaggt acacatatca ctatgatgct gattactctc ggtgggattc aacacaacag
     4321 agagccgtgt tggcagcagc tctagaaatc atggttaagc tctccccaga accacatttg
     4381 gctcaggtag tcgcggaaga ccttctttct cctagcgtgg tggatgtggg cgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaattccatc
     4501 gcccactggc ttctcactct ctgtgcgctc tctgaagtca caaacttgtc ccctgatacc
     4561 atacaggcta actccctctt ctctttttat ggtgatgatg aaattgttag cacagacata
     4621 aaattggacc cagaaaaatt gactacaaag ctcaaggaat atgggttaaa accaacccgc
     4681 cctgacaaaa ctgaaggacc ccttgtcatc tctgaagact tgaatggtct aaccttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatggag acccttctga aacaatgata
     4861 ccacactccc aaagacccat acaattgatg tccttgctgg gggaggccgc tctccacggc
     4921 ccaacattct acagcaaaat cagcaaattg gtcattgcag agttaaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagcctatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtctaatga
     5101 cgccaaccca tctgatgggt ccacagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgttg gtgccgctat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa acaattttgt acaagcccct ggtggagagt tcacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atttgaatcc
     5341 ctaccttttc ccattggcca gaaaggtcaa aggttatgca gggggttttg aagtgcaggt
     5401 aattcttgcg gggaaagcgt tccccgccgg gaaaatcata tttgcagcat ccccacccaa
     5461 ttttccaact gaaggcttga gtcccagcca ggtcactatg ttcccccata taatagtgga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacctgat gttaggaata acttctatca
     5581 ttataatcaa tcaaatgact ccaccatcaa attgatagca atgttgtata caccacttag
     5641 ggctaataat gctggggaag atgtcttcac agtctcttgt cgagttctta cgagaccatc
     5701 ccccgatttt gatttcatat ttttggtgcc acccacagtt gagtcaagaa ctaaaccatt
     5761 ctctgtccca attttaactg ttgaagaaat gaccaattca aggttcccca ttcctttgga
     5821 aaagttgttc acgggtccca gtagtacctt tgttgttcaa ccacaaaacg gcaggtgcac
     5881 gactgatggc gtgctcttag gcactaccca actgtctcct gtcaacatct gcacctttag
     5941 aggggatgtc acccacattg caggctctcg taattacaca atgaatttgg cttctcaaaa
     6001 ttggaacagt tatgacccaa cagaagaaat cccagcccct ctaggaactc cagatttcgt
     6061 ggggaagatt caaggtgtgc tcacccaaac cacaaggaga gatggttcga cccgcggcca
     6121 caaagctaca gtgtacactg ggagtgccga cttttctcca aaactgggta gagttcaatt
     6181 tgccactgac acagacaatg attttgatac tcaccaaaac acaaagttca ccccagtcgg
     6241 tgttatccag gatggtggta ctgcccaccg aaatgaaccc caacaatggg tgctcccaag
     6301 ttactcaggc agaaatactc ataatgtgca cctggcccct gctgtagccc ccactttccc
     6361 gggtgagcaa ctcctcttct tcagatctac tatgcccgga tgcagcgggt accccaacat
     6421 ggatttggat tgtctgcttc cccaggagtg ggtgcagtat ttctaccaag aagcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaatcca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataaat caggctatgt tacagtggcc cacaccggcc aacatgattt
     6601 ggttatcccc cccaatggtt attttagatt tgattcctgg gtcaaccagt tctacacact
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcattg taatggctgg agctttcttt
     6721 gctggattgg catctgacgt ccttggctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgaatttgaa aataacagaa aattgcaaca agcttccttc
     6841 caatttagta gcagtctaca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccaccaaaaa gttgcaacag gaaatggtga gagttaaaca agcaatgctc
     6961 ctagagggtg gattctctga gacagatgca gcccgtgggg caatcaacgc ccccatgaca
     7021 aaagttttag actggagcgg gacaaggtac tgggtccctg atgctaggac tacaacatat
     7081 aatgcaggcc gcttttccac ccctcaaccc ttgggggcac tgccaggaag agctaatctc
     7141 gggactgctg tccccgccca gggttcctcc agtacatctt ctaactcttc tattgctact
     7201 tctgtgtatt caaatcaaac catttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 aatgtctcga gcctcccgtc aactgcaagg actaggagct gggttgagga tcaaaacagg
     7321 aatttgtcac ctttcatgag gggggctcac aacatctcgt ttgtcacccc accatctagt
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca atacgcgcag gcagcctctc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggtgtaa
//