Typing tool

Complete norovirus genomes

AB933729  GII.4 New Orleans
 GII.P4 Hunter

Length: 7,506 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7506
LOCUS       AB933729                7506 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Fukui5/2009/JP genomic RNA, complete genome.
ACCESSION   AB933729
VERSION     AB933729.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Fukui5/2009/JP
  ORGANISM  Norovirus Hu/GII.4/Fukui5/2009/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7506)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7506
                     /organism="Norovirus Hu/GII.4/Fukui5/2009/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Fukui5/2009/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498723"
                     /country="Japan:Fukui"
                     /collection_date="2009"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30247.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDEVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKNIPPPPPNGEDDIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPNALKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDLIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMVSGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGSTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQNLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVAIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLAISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30248.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLATQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRADGSTRGHKAIVYTGSADFAPKLGRVQFATDTDNDFGANQNTKFTPVGVIQDG
                     DTAHRNEPQQWVLPSYSGRNSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7506
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30249.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGHFSTPQPSGALPGRAIRAVVPARGSSSISSN
                     SSAATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARARSWVEDQNRNLSPFMRGAHNIS
                     FVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHVRKRGESRA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacga agtgctttct agcatggctg tcactttcaa acgagccctc
      121 ggggcgcggc ctaaacagcc tcccccgagg gaaataccac aaagaccccc acgaccaccc
      181 actccagaac tgattaaaaa catcccccct cccccaccca acggagagga tgacatagtg
      241 gtttcttata gtgtcaaaga tggtgtctct ggtttgcctg atctttccac cgtcaggcaa
      301 ccggaagaat ctaatacggc cttcagtgtc cctccactca atcagaggga gaatagagat
      361 gctaaggagc cactgactgg aacaatcctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctgtatg tagagcgagg tcttgtgcta ggtgtgcaca aaccaccagc tgccatcagc
      481 ctcgctaggg tcgaactaac accactttcc ttgtactgga gacctgtgta tactccccag
      541 tacctcatct ctccaaacgc tctcaagaaa ctacacggag agacgttccc ctacacagcc
      601 tttgacaaca actgctacgc cttttgttgt tgggtcctgg acctaaacga ctcgtggctg
      661 agtaggagaa tgatccagag aacaactggc ttcttcagac cctaccaaga ttggaatagg
      721 aaacccctcc ccactatgga tgactccaag ttaaagaagg tagctaacat attcctgtgt
      781 gcactgtctt cgctattcac caggcctata aaagatttaa tagggaagct aaggcctctt
      841 aacatcctca acatcttggc ctcatgtgat tggacttttg caggcatagt ggagtccttg
      901 atactcttgg cagaactctt cggagttttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgatta cgaactacaa ggacctgagg accttgcagt agagctcgtc
     1021 cctgtagtga tggggggaat tggtttggtg ctaggattca ccaaagagaa gattgggaaa
     1081 atgttgtcat ctgctgcatc caccttgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttggtcat gaagtggttc ttcccgaaga aagaggaagc aaatgaattg
     1201 gctatagtaa gatccatcga ggatgcagtc ctggatctcg aggcaatcga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagacagt ctggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccaggaa actctcaacc aagtctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgctgct gcacgttctc tggtgcatcg agcgaaggag
     1441 gaactttcta gcagaccaag gccggtagtg ttgatggtat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctcccttac aggagaccag
     1561 cgtgtaggcc tcgtcccacg caatggcgtc gaccattggg atgcgtacaa gggggagagg
     1621 gtcgttctat gggacgacta tggaatgagc aaccctatcc acgatgccct cagattgcaa
     1681 gaactcgctg acacttgtcc cctcacccta aactgtgaca ggattgagaa caaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcacc actaatctgg ctaacccagc accactggac
     1801 tatgtcaact ttgaagcatg ctcgaggcgc atcgacttcc ttgtgtatgc agaagcccct
     1861 gaggtcgaaa aggcgaagcg tgacttccca ggtcaacccg acatgtggaa gaacgccttc
     1921 agttctgatt tctcacacat aaaactaaca ttggctccac agggtggctt cgacaagaac
     1981 gggaacaccc cacacgggaa gggcgtcatg aagactctca ccaccggctc ccttattgcc
     2041 cgggcatcag ggttactcca tgagaggcta gatgaatttg aactacaggg cccaactctc
     2101 accaccttca actttgatcg caataaagtg cttgccttta gacaacttgc tgctgaaaat
     2161 aaatatgggt tgatggacac aatgaaagtt gggaggcagc tcaaggatgt cagaacaatg
     2221 ccagagctca agcaagcact caagaatatt tcaatcaaga agtgccagat agtgtatagt
     2281 ggtagcacct acacacttga gtctgatggc aagggcaatg tgaaggttga cagagttcaa
     2341 agcgcctccg tgcagaccaa caatgagctg gctggcgccc tacaccatct aaggtgcgcc
     2401 agaataagat actatgtcag gtgtgtccag gaggccctgt attccatcat ccagattgct
     2461 ggggctgcat ttgtcaccac gcgcatcgtc aaacgcatga acatacaaaa cctatggtct
     2521 aagccacaag tggaaaatac agaggagact actagcaagg atgggtgtcc aaaacccaaa
     2581 gatgatgagg agttcgtcat ttcatccgac gacatcaaaa ctgagggcaa gaaagggaaa
     2641 aacaagactg gtcgcggcaa gaagcacaca gccttctcaa gcaaaggtct cagtgatgaa
     2701 gaatacgatg aatacaagag aattagagaa gaaaggaacg gtaagtactc catagaagag
     2761 taccttcagg acagggacaa atactatgag gaggtggcca ttgccagggc gactgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcaggcc aacaaggaaa
     2881 caacgcaagg aggaaagagc ttctctcggt ttagttacag gttctgaaat taggaaaaga
     2941 aatccagatg atttcaaacc caaggggaaa ctgtgggctg acgatgacag aagtgtggac
     3001 tacaatgaga aactcagttt tgaagcccca ccaagcatct ggtcgagaat agtcagcttt
     3061 ggttcaggtt gggggttctg ggtctccccc agtttgttca taacatcaac ccatgtcata
     3121 ccccagggag caaaggagtt ctttggagtc cccatcaaac aaattcaggt acacaagtca
     3181 ggcgaattct gtcgcttgag attcccaaaa ccaatcagga ctgatgtgac gggcatgatc
     3241 ttagaagaag gtgcacccga gggcaccgtg gtcacactgc tcatcaaaag gcccactgga
     3301 gaactcatgc ccctagcagc taggatgggg acccatgcaa ccatgaaaat ccaaggacgc
     3361 actgttgggg gtcaaatggg catgcttctg acaggatcca acgccaaaag catggatctg
     3421 ggtaccacac caggtgattg tggctgtccc tacatctaca agagaggaaa tgactatgtg
     3481 gccattggag tccacacggc tgccgctcgt gggggcaaca ctgtcatatg tgccacccag
     3541 gggagtgagg gagaggctac acttgaaggt ggtgacaata aagggacata ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca agaccaaatt ctggagatcg
     3661 tccacagcac cactcccacc tggcacctat gaaccagcct atcttggcgg caaggacccc
     3721 agagtcaagg gtggcccttc actacagcag gtcatgaggg atcagctgaa gccattcaca
     3781 gagcccaggg gcaagccacc aaagccaagt gtgttggaag ctgctaagaa aaccatcatc
     3841 aatgtccttg aacaaactat tgatccacct gagaaatggt cattcgcaca agcttgcgcg
     3901 tcccttgaca agaccacctc cagtggccat ccgcatcaca tgcggaaaaa cgactgctgg
     3961 aacggggagt ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agaacatgac gccagtctat acagctgcgc ttaaggacga attagttaaa
     4081 actgacaaaa tttatggcaa gatcaagaag aggcttctct ggggctcgga tttggcgacc
     4141 atgatccggt gtgctcgagc attcggaggc ctaatggatg aactcaaagc gcactgtgtc
     4201 acacttccca ttagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagagg
     4261 cactctaggt acacatacca ctatgatgct gattactctc gatgggattc aacacaacag
     4321 agagccgtgt tggcagcagc tctagaaatc atggttaagt tctccccaga accacatttg
     4381 gcccaggtag tcgcagaaga ccttctttct cctagcgtgg tggacgtggg tgacttcaca
     4441 atatcaatta acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcaccct ctgtgcgctc tctgaagtta caaacttgtc tcctgacacc
     4561 atacaagcta attccctctt ctctttttat ggtgatgatg aaattgttag cacagacata
     4621 aaattggacc cagaaaagtt gacagcaaag ctcagggaat acgggttaaa accaacccgt
     4681 cccgacaaaa ctgaaggacc ccttgccatc tctgaagact tgaatggcct gactttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagttcaata
     4801 ctcaggcaaa tgtactggac taggggctcc aaccatgaag acccatctga aacaatgatt
     4861 ccacactccc aaaggcccat acaactgatg tccctactgg gggaggccgc actccacggc
     4921 ccagcattct acagcaagat cagcaagtta gtcattgcag aactaaaaga aggtggcatg
     4981 gatttttacg tgcccagaca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ccacagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgttg gtgccgctat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa acaattttgt acaagcccct ggtggagagt tcacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atttgaatcc
     5341 ctacctttcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aatcctcgcg gggaacgcgt tcaccgccgg aaaaatcata tttgcagcag tcccaccaaa
     5461 tttcccaact gaaggcttga gccccagcca ggtcactatg ttcccccaca taatagtaga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacccgat gttaggaata atttctatca
     5581 ctacaatcaa tcaaatgacc ccaccatcaa attgatagca atgttgtata caccacttag
     5641 ggctaataat gctggggacg atgtcttcac agtttcttgt cgggttctca cgagaccatc
     5701 ccccgatttt gacttcatat ttttagtacc acccacagtt gagtcaagaa ctaaaccatt
     5761 ctctgttcca attttaactg ttgaggagat gaccaattca agattcccca ttcctttgga
     5821 aaagctgttc acgggtccca gcagtgcctt tgttgttcaa ccacaaaacg gcagatgcac
     5881 gactgatggc gtgctcctag gtaccactca actgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccatatta caggtagtcg taactacaca atgaatttgg ctactcaaaa
     6001 ttggaacagt tatgacccaa cagaagaaat cccagcccct ctaggaactc cagatttcgt
     6061 ggggaagatt caaggtgtgc tcacccaaac cacaagggca gatggctcga cccgcggcca
     6121 caaagctata gtgtacactg ggagcgccga tttcgctcca aaactgggta gagttcaatt
     6181 tgccactgac acagacaatg attttggtgc taaccaaaat acaaagttca ccccagtcgg
     6241 tgtcatccag gatggtgaca ctgcccaccg aaatgaaccc caacaatggg tgctcccaag
     6301 ttactcaggc agaaatagtc acaatgtgca cctggctccc gctgtagccc ccacttttcc
     6361 gggtgagcaa cttctcttct tcagatccac tatgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctgctcc cccaggaatg ggtgcagtat ttctatcaag aggcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaatcca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataaat caggctatgt tacagtggct cacaccggtc aacatgattt
     6601 ggttatcccc cccaatggtt attttagatt tgattcctgg gtcaaccagt tctacacact
     6661 tgcccccatg ggaaatggga cggggcgtag acgtgcatta taatggctgg agctttcttt
     6721 gctggattgg catctgacgt ccttggctcc ggacttggtt ctctgatcaa tgccggggct
     6781 ggggccatca accaaaaagt tgaatttgaa aataacagaa aattgcaaca agcttccttc
     6841 caatttagca gcaatctaca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccaccaaaaa gttgcaacag gaaatgatga gagttaaaca ggcaatgctc
     6961 ctagagggtg gattctctga gacagatgca gcccgtgggg caatcaacgc ccccatgaca
     7021 aaggctttgg actggagtgg gacaaggtac tgggctcccg atgctaggac cacaacatac
     7081 aatgcaggcc acttttccac ccctcaaccc tcgggggcac tgccaggaag agctattagg
     7141 gctgttgtcc ccgctcgggg ctcctccagc atatcttcta actcttctgc tgctacttct
     7201 gtgtactcaa atcaaactac ttcaacgaga cttggttcta cagctggttc tggtaccagt
     7261 gtctcgagcc tcccgtcaac tgcaagggct aggagctggg ttgaggatca aaataggaat
     7321 ttgtcacctt tcatgagggg ggcccacaac atatcgtttg tcaccccacc atctagcaga
     7381 tcctctagcc aaggcacagt ctcaaccgtg cccaaagaaa ttttggactc ctggactggc
     7441 gctttcaata cgcgcaggca gcctctcttc gctcacgttc gtaagcgagg ggagtcacgg
     7501 gcgtaa
//