Typing tool

Complete norovirus genomes

AB933728  GII.4 Den Haag
 GII.P12

Length: 7,467 | 3 CDS

ORF1: 1..5097
ORF2: 5081..6700
ORF3: 6700..7467
LOCUS       AB933728                7467 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Akita5/2009/JP genomic RNA, complete genome.
ACCESSION   AB933728
VERSION     AB933728.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Akita5/2009/JP
  ORGANISM  Norovirus Hu/GII.4/Akita5/2009/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7467)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7467
                     /organism="Norovirus Hu/GII.4/Akita5/2009/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Akita5/2009/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498722"
                     /country="Japan:Akita"
                     /collection_date="2009"
     CDS             1..5097
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30244.1"
                     /translation="MKMASNDAFAAAAANSNNDTAKSSSDRMFSNMAVTFKRALGARH
                     KQPPPKEIPQRPPRPPTPELVKKIPPPPPNGEDEPVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAVS
                     LARIELAPLSLYWRPVYTPQYLISPDTLKKLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVADVFLCALSSLFTRPIKDIIGK
                     VKPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSALIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKVGKMLSSAATTLRACKDLGAYGLEILKLVMKWFFP
                     KKEETNELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDVEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLARAL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     TGLLHERLDEYELQGPAPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     PELKQALKNVAIKSCQIVYGGCTYRLESDGKGEVKIDKVQNATVQTNNELDGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTSRIVKRMNIQDLWSKPQVEDTEETTSKDGC
                     PKPKDDDEFIVSSDDLKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLDFEAPPSVWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPKGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVASLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWTFAQACASLDKTTSSGHPHHLRKNDCW
                     NGESFTGKLADQASKANLMYEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVITEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGV"
     CDS             5081..6700
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30245.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAIPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQTKESTIKLVAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     SVESRTKPFTVPILTVEEMTNSRFPIPLERLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTRVSTTHVYEMNLASQNWNNYDPTEEVPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRAHKATVSTGAADFTPKLGSIRFETTTNRDLETHQNTKFTPVGVIQDG
                     DNHQNEPQQWRLPGYAGRDAHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYLTVAHTGPYDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6700..7467
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30246.1"
                     /translation="MAGAAVAGLASDVLSSGLGSLINAGAGVINQKVDFEHNRQLQQA
                     SFAFSNNQQQASFQHDKEMLQAQIEATKKLQQGMMKIKQAMLLEGGFSATDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFATPLPSGASPGRANPRATAPARGSPSTPS
                     NASTATSVYSNQTVSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRSLSSFSSRSSSQ
                     GTVSTVPKGVLDSWTGAFNTRRQPLFAYIRTRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgctttcgct gccgctgctg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacag aatgttttct aacatggctg tcacttttaa acgagccctt
      121 ggggcgcggc acaaacagcc tcccccgaag gaaataccac aaagaccccc acgaccaccc
      181 accccagaac tggtcaaaaa gatccctcct cccccaccca acggggagga tgaaccagtg
      241 gtttcttaca gcgccaaaga tggcgtttcc ggtttgcctg agctcaccac tgtccggcag
      301 ccggaagaga ccaacacggc gttcagcgtt cccccactca accagaggga gaacagggac
      361 gccaaggagc cactaaccgg aacgatcctg gaaatgtggg acggggagat ctaccattac
      421 ggtctgtatg tggaacgagg ccttgtactc ggtgtgcaca aaccaccagc tgccgtcagc
      481 ctcgccagga ttgaattggc tccactctcc ctgtactgga gaccagtgta cacaccacag
      541 tatctcatct ctccagacac tcttaagaaa ctgcacggag agtcgttccc ctacacagcc
      601 tttgataaca actgctatgc cttctgttgt tgggtcctgg acctaaacga ctcgtggttg
      661 tgcaggagaa tgatccagag gacaactggt ttcttcagac cttaccaaga ctggaacagg
      721 aaacccctcc ccaccatgga tgactccaag ctgaagaagg tagccgacgt attcttgtgc
      781 gcgctatctt cgctgttcac taggcccatc aaagatataa taggaaaagt gaaaccgctt
      841 aacatcctta acatcttggc ctcatgtgat tggacttttg caggcatagt ggaatctttg
      901 atcctcttgg cagagctctt tggagttttc tggacacccc cagatgtgtc tgcgttgatc
      961 gcccccttac taggtgatta cgaactgcag ggtcctgagg accttgcggt ggaactcgtt
     1021 ccagtggtga tgggggggat aggtttggtg ctgggattca ccaaagagaa ggtcgggaaa
     1081 atgttgtcat ctgctgcaac caccttaaga gcttgcaaag accttggtgc atacggactg
     1141 gaaatcctaa aattggttat gaagtggttc ttcccaaaga aagaggaaac aaatgagctg
     1201 gctatggtga gagccatcga ggatgcggtg ctggatctcg aggcaatcga gaacaaccac
     1261 atgaccaccc tcctcaaaga caaagacagc ttggcaacct acatgagaac cctcgacgtc
     1321 gaggaggaga aggccaggaa gctctcaacc aagtctgctt cacctgacat cgtgggcaca
     1381 atcaacgctc tcctggcgag aatcgccgct gcacgttccc tggtgcatcg ggcgaaagag
     1441 gaactctcca gcaggccaag gcctgtcgtt gtcatgatat caggcaaacc agggataggg
     1501 aaaactcacc ttgccagggc actggccaag aagatcgcag cttcgctcac aggagaccag
     1561 cgtgtaggcc tcatcccccg taacggtgtt gatcactggg atgcgtataa gggggaaaga
     1621 gtcgtcctat gggacgatta tggaatgagc aatcccatcc acgacgccct caggctacag
     1681 gaacttgctg acacctgccc cctcacgcta aactgtgaca gaattgagaa caaaggaaag
     1741 gtctttgaca gtgatgccat aatcatcacc actaatctgg ccaacccagc tccattggac
     1801 tatgtcaact ttgaagcatg ctcgaggcgc atcgacttcc tcgtgtacgc agaagcccct
     1861 gaggtcgaga aggcaaagcg tgatttccca ggtcaacctg acatgtggaa gaacgcattc
     1921 agccctgact tctcgcatat aaaattgacg ctggccccgc aaggtggctt cgacaagaac
     1981 ggaaacaccc cgcacgggaa aggcgtcatg aaaaccctca ccactggttc cctcatcgcc
     2041 cgagcaacag ggctactcca tgagaggtta gatgagtatg agctgcaggg cccagccccc
     2101 accaccttca actttgaccg caacaaggtg cttgcattca gacagcttgc tgccgaaaac
     2161 aagtacgggt tgttggacac aatgagagtt ggaaaacagc tcaaggatgt caagactatg
     2221 ccagagctca aacaagcact caagaacgtt gcaatcaaga gttgtcagat agtgtatggt
     2281 ggctgcactt ataggcttga gtctgacggc aagggtgaag tgaaaattga caaagttcag
     2341 aacgccactg tacagaccaa caatgagctt gacggcgccc tacaccacct taggtgtgcc
     2401 agaatcaggt attatgtcaa gtgtgtccag gaggccctgt attctatcat ccaaattgct
     2461 ggggctgcat ttgtgacctc gcgcattgtc aagcgcatga acatacaaga cctctggtcc
     2521 aagccacagg tggaggacac agaggagacc actagcaagg atgggtgccc aaaacccaag
     2581 gatgatgacg agttcattgt ctcatccgat gacctcaaaa ccgagggcaa aaaggggaag
     2641 aacaagtctg gccgtggtaa gaagcacacg gcattctcaa gtaaaggtct cagtgatgag
     2701 gagtatgatg agtacaaaag aatcagagaa gagaggaacg gcaagtactc catagaggaa
     2761 taccttcagg acagagacaa gtactatgag gaggtggcca tcgccagggc aaccgaagag
     2821 gacttctgtg aggaagaaga ggccaagatc cggcaaagga ttttcaggcc aacaaggaaa
     2881 caacgcaaag aggagagggc ctccctcggc ttggtcacag gctctgaaat caggaagagg
     2941 aacccagacg acttcaagcc caaaggaaaa ctgtgggctg atgacgacag gagtgtcgac
     3001 tacaatgaga gactcgactt tgaagcccca ccaagcgtct ggtcgaggat agtcaacttt
     3061 ggttcaggtt ggggcttttg ggtttccccc agtttgttca taacatcaac tcatgtcata
     3121 cccaagggcg cacaggagtt ctttggtgtc cccatcaaac aaattcaaat acacaaatcg
     3181 ggtgaattct gtcgcttgag gtttccaaaa ccaatcagaa ctgacgtgac aggcatgatc
     3241 ttagaggaag gtgcacccga ggggaccgtg gcctcactac tcatcaagag gccaactgga
     3301 gaactcatgc ccttggcagc cagaatggga acccatgcaa ccatgaagat ccaagggcgc
     3361 actgtcggag gtcagatggg catgctccta acaggatcta atgccaagag catggacctg
     3421 ggcaccacac caggtgactg tggctgcccc tacatctaca agagggggaa tgactatgta
     3481 gtcattggag tccacacagc tgccgcccgt ggaggaaaca ctgtcatatg tgccacccag
     3541 gggggcgaag gagaagccac acttgagggc ggtgacaaca aggggaccta ctgcggtgca
     3601 ccaatcttag gtccaggaag tgcaccgaag ctcagcacca agactaaatt ctggaggtca
     3661 tccacggcac cacttccacc tggtacctat gagccagcct acctcggcgg caaggacccc
     3721 agagttaagg gtggcccttc attacaacaa gttatgaggg accagctgaa accattcact
     3781 gaacccaggg gaaaaccacc aaaaccaagt gtgttagaag ctgccaagaa aaccatcatt
     3841 aatgtccttg aacaaacaat tgacccacct gaaaagtgga catttgcgca ggcatgtgca
     3901 tcccttgaca agaccacttc cagcggtcac ccccaccact tgcggaaaaa tgactgctgg
     3961 aacggggagt cctttacagg caagttggca gaccaggctt ccaaggccaa cctgatgtac
     4021 gaggagggaa agaacatgac cccagtctac acgggtgcgc ttaaggacga gctggtcaag
     4081 actgacaaga tttatggcaa gatcaaaaag aggcttctct ggggttcgga cctggcgacc
     4141 atgatccggt gcgctcgagc attcgggggc ctgatggagg aactcaaggc acattgtgtc
     4201 acactacctg tcagagtggg tatgaatatg aatgaggatg gtcctatcat ctttgagaga
     4261 cactccagat ataaatacca ttatgatgct gattactccc ggtgggattc aactcaacaa
     4321 agagccgtgt tggcagcggc cttggaaatc atggtcaaat tctccccaga gccgcatctg
     4381 gcccaaaagg ttgcagaaga ccttctttct cccagcgtga tggacgtggg tgatttcaaa
     4441 atatcaatca atgagggtct cccctccggg gtgccctgca cctctcagtg gaactccatt
     4501 gcccactggc tcctcactct gtgtgcactc tctgaggtta caaacctgtc ccctgacatc
     4561 atccaggcca actcactctt ctctttctac ggtgatgatg aaattgtgag cacagacata
     4621 aaattggacc cggaaaagct aacagcaaaa ctcaaggaat acgggttgaa accgacccgt
     4681 cctgacaaga ctgagggacc cctcgtcatc actgaagacc tgaacggcct aaccttcctg
     4741 cggaggaccg tgacccgcga tccagcaggc tggtttggaa agttggaaca gagttcaata
     4801 ctcagacaaa tgtactggac taggggcccc aaccatgaag acccatctga aacaatgata
     4861 ccacactccc aaaggcccat acaattgatg tctctgctgg gtgaggctgc actccacggt
     4921 ccagcattct acagcaaaat cagcaaactg gtcattgcag agttgaagga aggtggcatg
     4981 gatttttacg tgccaagaca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtctaacga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgttg gtgccgctat cgcggcaccc gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagga acaattttgt acaagcccct ggtggagagt tcacagtgtc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atctgaaccc
     5341 atacctttcc cacctggcca gaatgtacaa tggttatgca ggtggctttg aagtgcaggt
     5401 aatccttgcg gggaacgcgt tcaccgcagg taaaatcata tttgcagcaa tcccaccaaa
     5461 ttttccaact gaaggcttga gccccagtca ggtcactatg ttcccccata tagtagtaga
     5521 tgttaggcaa ttggaacctg tattgatccc cttacctgat gttaggaaca atttctacca
     5581 ctacaatcaa acaaaagagt ccaccatcaa attggtagca atgctgtaca caccacttag
     5641 ggctaataat gctggggatg atgtcttcac agtctcttgt cgagtcctca cgagaccatc
     5701 ccccgatttt gatttcatat ttctggtgcc accctcagtt gaatcaagaa ccaaaccatt
     5761 caccgtccca attttaactg ttgaggaaat gaccaattca agattcccca tacctttgga
     5821 aagattgttc acgggtccta gcagtgcctt tgtcgtccag ccacaaaatg gcaggtgcac
     5881 gactgatggc gtgctcttag gcaccaccca actgtccccc gtcaacatct gcaccttcag
     5941 aggggacgtc acccgagttt caaccactca tgtttatgaa atgaatttgg cttctcaaaa
     6001 ttggaataat tatgacccaa cagaagaagt cccagcccct ctgggaactc cagattttgt
     6061 gggaaagatc caaggcgtgc tcacccaaac cacaaggaca gacggttcga cccgcgccca
     6121 caaagcaacg gtgagcactg gggctgccga cttcactcca aaactgggca gcatccggtt
     6181 cgaaaccacc acgaaccgtg atcttgaaac tcaccaaaac acaaagttca ccccagtcgg
     6241 tgtcatccag gatggtgaca accaccaaaa tgaaccccaa caatggagac tcccaggtta
     6301 cgcaggtagg gatgctcaca acgtgcacct agcccctgcc gtagccccca ctttcccggg
     6361 tgagcaactc cttttcttca gatccaccat gcccggatgc agtgggtatc ccaacatgaa
     6421 tttggattgt ctactccccc aagaatgggt gcagcacttc taccaagagg cagccccagc
     6481 acaatctgat gtggctctgt tgagattcgt gaatccagac acgggtagag ttctgtttga
     6541 gtgcaagctt cacaaatcag gctatctcac agtggcccac accggcccgt atgatttggt
     6601 catccccccc aatggctact tcagatttga ttcgtgggtc aaccagttct acactcttgc
     6661 ccccatggga aatggaacgg ggcgtagacg tgcattataa tggctggagc tgccgttgct
     6721 ggattggcat ctgatgtcct tagctctgga cttggttctc taatcaatgc tggggctggg
     6781 gtcattaacc aaaaagttga ttttgaacac aacagacaat tgcaacaagc ttcctttgct
     6841 ttcagcaaca atcaacaaca ggcttccttt caacatgaca aagagatgct ccaagcacaa
     6901 attgaggcca ccaaaaagtt acagcagggt atgatgaaaa tcaaacaggc aatgctccta
     6961 gagggtgggt tctctgcaac agatgcggcc cgtggggcaa tcaacgcccc catgacaaag
     7021 gctttggact ggagcggaac aaggtactgg gctcctgatg ctagaactac aacatacaat
     7081 gcaggccgct ttgccacccc tctaccttcg ggggcatcgc caggaagagc taaccccagg
     7141 gctactgccc ccgctcgggg ctcccccagc actccttcta atgcttctac tgctacttct
     7201 gtctattcaa atcaaactgt ttcaacgaga cttggttcta cagctggttc tggcaccagt
     7261 gtctcgagtc tcccgtcaac tgcaaggact aggagttggg ttgaggacca aaacaggagt
     7321 ttgtcatctt tctccagtag gtcctctagc cagggcacag tctcaaccgt gcccaaagga
     7381 gttttggact cctggactgg cgctttcaac acgcgcaggc agcctctctt cgcttacatt
     7441 cgtacgcgag gggagtcacg ggtgtaa
//