Typing tool

Complete norovirus genomes

AB933720  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5097
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933720                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Hiroshima2/2011/JP genomic RNA, complete genome.
ACCESSION   AB933720
VERSION     AB933720.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Hiroshima2/2011/JP
  ORGANISM  Norovirus Hu/GII.4/Hiroshima2/2011/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Hiroshima2/2011/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Hiroshima2/2011/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498714"
                     /country="Japan:Hiroshima"
                     /collection_date="2011"
     CDS             1..5097
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30220.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQKPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKSISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATSKDGC
                     PKPKDNEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDGKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVMDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGV"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30221.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKVQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30222.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKILDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPVRTNPRTPAPARGSPSTSS
                     NASTATSIHSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWIEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRA"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcactttcaa acgagccctc
      121 ggggcgcggc ctaaacagcc ccccccgagg gaaataccac aaaaaccccc acgaccacct
      181 actccagaac tggtcaaaaa gatccctccc cccccgccca acggagagga tgaagtagtg
      241 gtttcttata gtgccaaaga tggtgtctcc ggtttacctg agctttccac cgttaggcaa
      301 ccggacgaaa ccaatacggc tttcagtgtc cctccactca atcagaggga gaatagggat
      361 gctaaggaac cactgactgg aacaattctg gaaatgtggg atggagaaat ttaccattat
      421 ggcctgtatg ttgagcgagg tcttgtgctg ggtgtgcaca aaccaccagc tgccattagc
      481 ctcgccaagg tcgaactaac accactctcc ttgttctgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttacacggag aaacatttcc ctacacagcc
      601 ttcgacaaca attgctatgc cttttgttgc tgggtcctgg atctaaacga ctcgtggcta
      661 agtaggagaa tgatccagag aacaactggc ttcttcagac cttaccaaga ttggaatagg
      721 aaacccctcc ccactatgga tgactccaaa ttaaagaagg tagctaacat attcctgtgc
      781 actctgtctt cgctgttcac caggcccata aaagacataa tagggaagtt aaggcctctc
      841 aacatcatca acatcctggc ttcatgtgat tggactttcg caggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac ttggtgattt cgagttgcaa ggacctgagg accttgtagt ggagctcgtc
     1021 cctgtagtaa tggggggaat tggtttggtg ctaggattca ccaaagagaa gattggaaaa
     1081 atgttgtcat ctgctgcatc caccttgaga gcttgtaaag atcttggtgc gtatgggcta
     1141 gagatcctaa agttagtcat gaagtggttc ttcccgaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagtg ctggaccttg aggcaattga aaacaaccat
     1261 atgactacct tgctcaaaga caaagacagc ctggcaacct atatgagaac ccttgatctc
     1321 gaggaagaga aagccagaaa actctcaacc aagtctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgccgct gcacgctccc tggtgcaccg agcgaaggag
     1441 gagctctcta gtagaccaag acctgtagtc ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctccctcac aggagaccag
     1561 cgtgtgggcc tcatcccacg caatggcgtt gatcactggg acgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgacta tggaatgagc aatcccatcc acgacgccct caggctgcaa
     1681 gaactcgctg acacttgccc cctcactcta aattgtgaca ggattgagaa taaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcact actaacctgg ccaacccagc accactggac
     1801 tatgtcaact ttgaagcgtg ctcgaggcgc attgatttcc tcgtgtatgc agaagccccc
     1861 gaggtcgaaa aggcaaagcg tgacttcccg ggccaacctg acatgtggaa aaacgctttt
     1921 agttctgatt tctcacacat aaaattggca ctggccccac aaggtggctt tgataagaac
     1981 gggaacaccc cacatgggaa gggcgtcatg aagactctca ccactggctc cctcattgcc
     2041 cgggcatcag ggctgctcca tgagagattg gatgagtttg agctacaggg cccagctctc
     2101 accaccttca actttgaccg caacaaagtg cttgccttca ggcagcttgc tgctgaaaac
     2161 aaatacgggt tgatggacac aatgaaggtt gggaggcagc tcaaagatgt caagactatg
     2221 ccagaactta aacaagcact caagagtatc tcaatcaaga agtgccagat tgtgtatagt
     2281 ggctgcacct acacacttga gtctgacggc aagggcaatg tgaaagttga cagagttcag
     2341 agcacctccg ttcagaccaa caatgagctg gctggcgcct tgcaccacct gaggtgcgcc
     2401 agaatcaggt actatgtcaa gtgtgttcag gaggccctgt attctatcat ccagattgct
     2461 ggggctgcat ttgtcaccac gcgcatcatc aagcgtgtga acattcaaga cttatggtcc
     2521 aagccacaag tggaaaacac agaggaggcc accagcaagg acgggtgccc aaaacccaaa
     2581 gataatgaag agttcgtcat ttcatctgac gacattaaaa ctgagggtaa gaaagggaag
     2641 aacaagactg gtcgtggcaa gaagcacaca gccttctcaa gtaaaggtct cagtgatgaa
     2701 gagtatgatg agtacaagag aattagagag gaaaggaatg gtaagtactc catagaagag
     2761 taccttcagg atagggacag atactacgag gaggtggcca ttgccagggc aaccgaggaa
     2821 gatttctgtg aagaggagga ggccaagatc cggcaaagga tcttcagacc aacaaggaaa
     2881 caacgcaagg aagaaagagc ttctctcggt ttagtcacgg gttctgaaat caggaaaagg
     2941 aacccagaag acttcaagcc taaggggaaa ctatgggctg acgatgacag aagtgtggac
     3001 tacaatgaaa aactcagttt tgaggcccca ccaagcatct ggtcaaggat agtcaacttt
     3061 ggctcaggtt ggggcttctg ggtctccccc agcctgttta taacatcaac ccacgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt acacaagtca
     3181 ggcgaattct gtcgcttgag gttcccaaaa ccaatcagga ctgatgtgac tggcatgatc
     3241 ttggaagagg gtgcgcccga aggcaccgtg gtcacactac tcatcaagag gtctactgga
     3301 gagctcatgc ccctagcagc tagaatgggg acccatgcaa ccatgaaaat tcaagggcgc
     3361 actgttggag gtcagatggg catgcttctg acaggatcca acgccaaaag catggatcta
     3421 ggcaccacac caggtgattg cggctgcccc tacatctaca agagaggaaa tgattatgtg
     3481 gtcattggag tccacacggc tgccgctcgt gggggaaaca ctgtcatatg tgccacccag
     3541 gggggtgagg gggaagctac acttgaaggt ggtgacggta agggaacata ctgtggcgca
     3601 ccaatcctag gcccagggag tgccccaaaa ctcagcacca aaaccaaatt ctggagatca
     3661 tccacagcac cactcccacc tggcacctat gaaccagcct accttggtgg caaggacccc
     3721 agagtcaagg atggcccctc gttgcagcaa gttatgaggg accagctgaa accatttaca
     3781 gagcctaggg gtaagccacc aaagccaagt gtgttagaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaaatggt cgtttgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgattgctgg
     3961 aatggggaat ctttcacagg caagctggca gaccaggctt ccaaggctaa cctgatgttt
     4021 gaagaaggga agaacatgac cccagtctac acaggtgcac ttaaggatga attagtcaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttggcaacc
     4141 atgatccggt gtgctcgagc attcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acactcccca tcagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagaag
     4261 cattccaggt acagatacca ctacgatgct gactactctc ggtgggattc aacacagcag
     4321 agagccgtgc tggcagctgc tctagaaatc atggttaaat tctcctcaga accacatttg
     4381 gctcaggtag tagcagaaga ccttctttct cctagcgtga tggacgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcactct ctgtgcactc tccgaagtca caaatttgtc cccagacatc
     4561 atacaggcca attctctctt ctccttctat ggtgatgatg aaattgttag tacagacata
     4621 aaattagacc cagagaagtt gacagcaaag cttaaggaat acgggttgaa accaacccgc
     4681 cctgataaaa ctgaaggacc tcttgttatt tctgaagact tagatggttt gactttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatgaag acccatctga atcaatgatt
     4861 ccacactctc aaagacccat acaattgatg tccttactgg gagaggccgc actccacggc
     4921 ccaacattct acagtaaaat cagcaaatta gtcattgcag agttaaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtctagtga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgtcg gtgccgctat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtgtc
     5281 ccctagaaac gctccgggtg aaatactatg gagcgcgccc ttaggccctg atctgaatcc
     5341 ctacctgtct catttggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gattctcgcg gggaacgcgt tcaccgccgg aaaaattata tttgcagcag ttccaccaaa
     5461 ttttccaact gaaggcttga gtcccagcca ggtcactatg ttcccccata taatagtgga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacctgat gttaggaata acttttacca
     5581 ctataatcag tcaaatgact ctaccattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtttttac agtctcttgt cgagttctca cgaggccatc
     5701 ccctgatttt gattttatat ttttggtgcc acctacagtt gagtcaagaa ctaaaccatt
     5761 tactgtccca atcttaactg ttgaagaaat gaccaattca agattcccca ttcctttgga
     5821 aaaattgttc acgggcccca gcagcgcctt tgttgttcaa ccacaaaatg gcagatgcac
     5881 gactgatggt gtgctcttag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccacattg caggttctcg taattacaca atgaatttgg cttctctaaa
     6001 ttggaacaat tatgacccaa cagaagaaat tccagcccct ctaggaactc cagattttgt
     6061 gggaaaggtc cagggtgtgc tcacccaaac cacaaaggga gatggttcga cccgtggcca
     6121 taaagctaca gtttacactg ggagtgcccc ctttactcca aagctgggca gtgttcaatt
     6181 cagtactgac acagaaaatg attttgaaac tcaccaaaac acaaaattca ccccagtcgg
     6241 tgtcatccag gatggtagca ccacccaccg aaatgaaccc caacaatggg tgctcccaag
     6301 ttattcaggt agaaatgtcc ctaatgtaca cctagcccct gctgtagccc ccactttccc
     6361 gggtgaacaa cttcttttct ttaggtctac tatgcccgga tgcagcgggt atcccaacat
     6421 ggatttggat tgcctactcc ctcaggagtg ggtgcagcac ttctaccaag aggcagctcc
     6481 agcacaatct gatgtggctc tattgaggtt tgtgaaccca gacacgggta gggtcctatt
     6541 tgagtgtaaa cttcataaat caggttatgt cacagtggct cacaccggcc agcatgattt
     6601 ggtcatcccc cccaatggtt attttaggtt tgattcctgg gttaatcaat tctacacact
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcctta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt tcttagctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggctatca accaaaagat tgattttgaa aataacagaa aattgcagca agcttccttc
     6841 cagtttagca gtaatctaca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccactaaaaa gttgcaacag gaaatgatga gagtcaaaca ggcaatgctc
     6961 ttagaaggtg gattttctga aacagatgca gcccgtgggg caatcaacgc ccctatgaca
     7021 aagattttgg actggagcgg aacaaggtac tgggcccctg atgctaggac tacaacatac
     7081 aatgcaggcc gcttttccac ccctcaacct tcgggggcac tgccagtaag aaccaatccc
     7141 aggactcctg cccccgctcg gggctccccc agtacatctt ctaatgcttc cactgctact
     7201 tctatacatt caaatcaaac tgtttcaacg agacttggtt ctacagctgg ttctggcacc
     7261 aatgtctcga gtctcccgtc aactgcaagg actaggagct ggattgagga tcaaaacaga
     7321 aacttgtcac ctttcatgcg gggggctcac aacatatcgt ttgtcacccc tccatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca atacgcgcag gcagcctctc ttcgctcaca tccgtaggcg aggggagtca
     7501 cgggcgtaa
//