Typing tool

Complete norovirus genomes

AB933704  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933704                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Ehime1/2011/JP genomic RNA, complete genome.
ACCESSION   AB933704
VERSION     AB933704.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Ehime1/2011/JP
  ORGANISM  Norovirus Hu/GII.4/Ehime1/2011/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Ehime1/2011/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Ehime1/2011/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498698"
                     /country="Japan:Ehime"
                     /collection_date="2011"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30172.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPSPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSVKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKRCQIVYNGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDVEEFVISFDDIKAEGKKGKNKAGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKNGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30173.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQYDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30174.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRINPRTPTPARGSPSTSS
                     NASTATSIYSNQTASTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRRKSRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc ctccccgagg gaaataccac aaagaccccc acgaccacct
      181 actccagaac tggtcaaaaa gatccctcct cccccgccca acggggagga tgaagtagtg
      241 gtttcttata gtgtcaaaga tggcgtttcc ggtttacctg agctttccac cgtcaggcaa
      301 ccggaagaaa ccaatacggc cttcagtgtc cctccactca atcagaggga gaatagggat
      361 gctaaggagc cactgactgg aacaattctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctgtatg ttgagcgagg ccttgtgctg ggtgtgcaca aaccaccagc tgccattagc
      481 ctcgccaagg tcgagctaac accactctcc ttgttctgga ggcctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttgcacggag aaacattccc ctacacagcc
      601 ttcgacaaca actgctatgc cttttgttgc tgggtcctgg atctaaacga ctcatggctg
      661 tgtaggagaa tgatccagag aacaactggc tttttcagac cctaccaaga ttggaatagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagctaatat attcctgtgt
      781 accctgtctt cgctatttac caggcccata aaagacataa tagggaagtt aaggcctctc
      841 aacatcatca acatcctggc ttcatgtgac tggactttcg caggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacgcccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgattt cgagttacaa ggacctgagg accttgtagt ggagctcgtc
     1021 cctgtagtaa tggggggaat tggtttggtg ctaggattca ccaaagagaa gattggaaaa
     1081 atgttgtcat ctgctgcatc taccttgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttagtcat gaagtggttc ttcccgaaga aagaggaagc aaatgaattg
     1201 gctatggtga gatccatcga ggatgcagta ctggatcttg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagatagt ctggcaacct atatgagaac ccttgacctc
     1321 gaggaagaga aagccagaaa actctcaacc aaatctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgccgct gctcgctccc tggtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag acctgtagtc ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctccctcac aggagaccag
     1561 cgtgttggcc tcatcccacg caatggcgtc gatcactggg atgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgacta tggaatgagc aatcccatcc acgatgccct caggctgcaa
     1681 gaactcgctg acacttgccc cctcactcta aattgtgaca ggattgagaa caaaggaaag
     1741 gtctttgaca gcgatgtcat catcatcact actaacctgg ccaacccagc accactggac
     1801 tatgtcaact ttgaagcgtg ctcgaggcgt atcgatttcc tcgtgtatgc agaagccccc
     1861 gaggtcgaaa aggcgaagcg tgacttcccg ggtcaacctg acatgtggaa aaacgcgttt
     1921 agttctgatt tctcacacat aaaattggca ctggctccgc aaggtggctt tgataagaac
     1981 gggaacaccc cacacgggaa gggcgtcatg aagactctca ccaccggctc cctcattgcc
     2041 cgggcatcag ggctgctcca cgagagattg gatgagtttg aactacaggg cccagctctt
     2101 accaccttca actttgaccg caacaaagtg cttgccttca ggcagcttgc tgctgaaaac
     2161 aaatacgggt tgatggacac aatgaaagtt gggagacagc tcaaggatgt caaaaccatg
     2221 ccagaactta aacaagcact caagaatatc tcaatcaaga ggtgccagat tgtgtataat
     2281 ggctgcacct acacacttga gtctgatggt aagggcaatg tgaaagttga cagagttcag
     2341 agcacctccg ttcagaccaa caatgagctg gctggcgccc tgcaccatct aaggtgcgcc
     2401 agaatcaggt attatgtcaa gtgtgtccag gaggccctgt attccatcat ccagattgct
     2461 ggggctgcat ttgtcaccac gcgcatcatt aagcgtgtga acatccaaga cttatggtcc
     2521 aagccacaag tggaaaacac agaggaggct accaacaagg acgggtgccc aaaacccaaa
     2581 gatgttgagg agttcgtcat ttcatttgac gacattaaag ctgagggtaa gaaagggaag
     2641 aacaaggctg gccgtggcaa gaagcacaca gccttctcaa gtaaaggtct cagtgatgaa
     2701 gagtacgatg agtacaagag aattagagag gaaaggaatg gcaagtactc catagaagag
     2761 tacctacagg acagggacaa atactatgag gaggtggcca ttgccagggc gaccgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcaggcc aacaaggaaa
     2881 caacgcaagg aagaaagagc ttctctcggc ttagtcacag gttctgaaat taggaaaagg
     2941 aacccagagg acttcaagcc taaggggaaa ctatgggctg acgatgacag aagtgtggac
     3001 tacaacgaaa aactcagctt tgaggcccca ccaagcatct ggtcaaggat agtcaacttt
     3061 ggctcaggtt ggggcttctg ggtctccccc agcctgttca taacatcaac ccacgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt gcacaaatca
     3181 ggcgaattct gtcgcttgag gttcccaaag ccaatcagga ctgatgtgac tggcatgatc
     3241 ttggaagaag gtgcgcccga aggcaccgtg gccacactac tcatcaaaag gtctactgga
     3301 gaactcatgc ccctagcagc tagaatgggg acccatgcaa ccatgaagat tcaagggcgc
     3361 actgttgggg gtcagatggg catgctcctg acaggatcca acgccaaaag catggatcta
     3421 ggcaccacac caggtgattg cggctgtccc tacatctaca agagaggaaa tgattatgtg
     3481 gtcattggag tccacacggc tgctgctcgt gggggaaaca ctgtcatatg tgccacccag
     3541 gggggtgaag gggaagctac acttgaaggt ggtgatagta agggaacata ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca aaaccaaatt ctggagatca
     3661 tccacagcac cactcccacc tggcacctat gaaccagcct acctaggtgg caaggacccc
     3721 agggtcaaaa atggcccctc gttgcagcaa gtcatgaggg accagctgaa accatttaca
     3781 gagcctaggg gtaagccacc aaagccaagc gtgttagaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaagtggt cgttcgcaca agcttgcgcg
     3901 tcccttgaca aaaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggaat ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agaacatgac cccagtctac acaggtgcac ttaaggatga attagtcaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttagcaacc
     4141 atgatccggt gtgctcgagc gttcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acacttcctg tcagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagaag
     4261 cactccaggt acagatacca ctatgatgct gattactctc ggtgggattc aacacaacag
     4321 agagccgtgc tggcagccgc tctagaaatc atggttaaat tctcctcaga accacatttg
     4381 gctcaggtag tagcagaaga tcttctttct cctagcgtgg tggatgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcactct ctgtgcactc tccgaagtta caaatttgtc cccagacatc
     4561 atacaggcta attctctctt ctccttctat ggtgatgatg aaattgttag tacagatata
     4621 aagttagacc cagagaagtt gacagcaaag cttaaggaat acgggttgaa accaacccgc
     4681 cctgataaaa ctgaaggacc tcttgttatt tctgaagact tagatggttt gactttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatgaag atccatctga atcaatgatt
     4861 ccacactctc aaagacccat acaattgatg tccttactgg gagaggccgc actccacggc
     4921 ccaactttct atagtaaaat cagcaaatta gtcattgcag agcttaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgaatga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgtcg gtgccgctat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtgtc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atctgaatcc
     5341 ctacctatct cacttggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gatcctcgcg gggaacgcgt tcaccgccgg gaaaattata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttga gtcccagcca ggtcactatg ttcccccaca taatagtgga
     5521 tgttaggcaa ttggaacctg tgttgatccc cctacctgat gttaggaata acttctatca
     5581 ctataatcag tcaaatgatt ctaccattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtctttac agtctcttgt cgagttctca cgaggccatc
     5701 ccctgatttt gattttatat ttttggtgcc acctacagtt gagtcaagaa ctaaaccatt
     5761 tactgtccca atcttaactg ttgaagaaat gaccaattca aggttcccca ttcctttgga
     5821 aaaattgttc acgggtccta gcagtgcctt tgttgttcaa ccacaaaatg gcagatgcac
     5881 gactgatggc gtgctcttag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccacattg caggttctcg taattacaca atgaatttgg cctctctaaa
     6001 ttggaacaat tatgacccaa cagaagaaat tccagcccct ctaggaactc cagattttgt
     6061 gggaaagatc caaggtgtgc tcactcaaac cacaaaggga gatggctcga cccgtggcca
     6121 taaagctaca gtctacactg ggagtgcccc ctttactcca aagctgggca gtgtccaatt
     6181 cagtactgat acagagaatg attttgaaac tcaccaaaac acaaagttca ccccagtcgg
     6241 tgtcatccag gatggtggca ccacccatcg aaatgaaccc caacaatggg tgctcccaag
     6301 ttattcaggt agaaatgtcc ctaatgtaca cctagcccct gctgtagccc ccacttttcc
     6361 gggtgaacaa cttcttttct ttaggtccac tatgcccgga tgcagcgggt atcccaacat
     6421 ggatttggac tgcctactcc cccaggagtg ggtgcagcac ttctaccaag aagcagctcc
     6481 ggcacaatct gatgtggctc tattgagatt tgtaaatcca gacacgggta gggtcctgtt
     6541 tgagtgcaaa cttcataaat caggctatgt cacagtggct cacaccggcc agtatgattt
     6601 ggtcatcccc cccaatggtt attttaggtt tgattcctgg gtcaatcaat tttacacact
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcttta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttagctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggctatca accaaaagat tgattttgaa aataacagaa aattgcagca agcttccttc
     6841 cagtttagta gtaatctaca acaggcttcc tttcaacatg acaaagagat gctccaagca
     6901 caaattgagg ccactaaaaa gttgcaacag gaaatgatga aagtcaagca ggcaatgctc
     6961 ttggaaggtg gattctctga aacagatgca gcccgtggag caatcaacgc ccctatgaca
     7021 aaggctttgg actggagcgg aacaaggtac tgggcccctg atgctaggac tacaacatac
     7081 aatgcaggcc gtttctccac ccctcaacct tcgggggcac tgccaggaag aatcaatccc
     7141 aggactccta cccccgctcg gggctccccc agcacatctt ctaatgcttc tactgctact
     7201 tctatatatt caaatcaaac tgcttcaacg agacttggtt ctacagctgg ttctggcacc
     7261 aatgtctcga gtctcccgtc aactgcaagg actaggagtt gggttgagga tcaaaacaga
     7321 aatttgtcac ctttcatgag aggggctcac aacatatcat ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca ttcgtaggcg aaggaagtca
     7501 cgggtgtga
//