Typing tool

Complete norovirus genomes

AB933698  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5097
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933698                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Hiroshimacity2/2011/JP genomic RNA, complete
            genome.
ACCESSION   AB933698
VERSION     AB933698.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Hiroshimacity2/2011/JP
  ORGANISM  Norovirus Hu/GII.4/Hiroshimacity2/2011/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Hiroshimacity2/2011/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Hiroshimacity2/2011/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498692"
                     /country="Japan:Hiroshimacity"
                     /collection_date="2011"
     CDS             1..5097
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30154.1"
                     /translation="MKKASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDETVCSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAADRSLPPRAKEELSRTSRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALPLQELDDTC
                     PLTLNCDRIENKGKVFDSDVLIITTNLANPAPLDYVNLEARSRRIDFLVYAETPEVEK
                     AKHDFPGRPDMWKNAFSSDFSHIRLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNTSIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDNEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVAGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKVSKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGV"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30155.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFKGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHQNEPQQWVLPSYSGRDVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30156.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKVDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATRKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGVLPGRTNPRTPTPARGSPSTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEGQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 atgaagaagg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcactttcaa acgagccctc
      121 ggggcgcggc ctaaacagcc ccccccgagg gaaataccac aaagaccccc acgaccacct
      181 actccagaac tggtcaaaaa gatccctccc cccccgccca acggagagga tgaaacagta
      241 tgttcttata gtgctaaaga tggtgtttcc ggcttacctg agctctccac tgtcaggcaa
      301 ccggaagaaa ccaatacggc tttcagtgtc cctccactca atcagaggga gaatagggat
      361 gctaaggaac cactgactgg aacgattctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctatatg ttgagcgagg tcttgtgctg ggcgtgcaca aaccaccagc tgccattagc
      481 ctcgcaaagg tcgaactaac accactctcc ttgttctgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttgcacggag aaacattccc ctacacagcc
      601 ttcgacaaca actgctatgc cttctgttgc tgggtcctgg atctaaacga ctcgtggctg
      661 agtaggagaa tgatccaaag aacaactggc ttcttcagac cctaccaaga ttggaatagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagctaacat attcctgtgc
      781 accctgtctt cgctattcac caggcccata aaagacataa tagggaagtt aaggcctctc
      841 aacatcatca acatcctggc ttcatgtgat tggactttcg caggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggggattt cgagttacaa ggacctgagg atcttgtagt ggagctcgtc
     1021 cctgtagtaa tggggggaat tggtttggtg ctaggattca ccaaagagaa gattggaaaa
     1081 atgttgtcat ctgctgcatc taccttaaga gcttgtaaag atcttggtgc gtatgggcta
     1141 gagatcctaa agttagtcat gaagtggttc ttcccgaaga aagaggaagc aaatgaactg
     1201 gccatggtga gatccatcga ggatgcagtg ctagatcttg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagacagc ctggcaacct atatgagaac ccttgacctc
     1321 gaggaagaga aagccagaaa actttcaacc aagtctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgccgct gatcgctccc tgcctccccg agcgaaggag
     1441 gagctttctc gcacgtctag acctgtagtc ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctccctcac aggagaccag
     1561 cgtgtaggcc tcatcccacg caatggcgtc gatcactggg atgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgacta tggaatgagc aatcccatcc acgacgccct cccgctgcaa
     1681 gaactcgatg acacttgccc cctcactcta aactgtgaca ggattgagaa caaaggaaag
     1741 gtctttgaca gcgatgtcct cattatcact actaacctgg ccaaccctgc accactggac
     1801 tatgtcaact tggaagctcg ctcgaggcgc attgatttcc tcgtgtatgc agaaaccccc
     1861 gaggtcgaaa aggcgaagca tgacttcccg gggcgacctg acatgtggaa aaacgctttt
     1921 agttctgatt tctcacacat aagattggca ctggctccac aaggtggctt tgataagaac
     1981 gggaacaccc cacatgggaa gggcgtcatg aagactctca ccactggctc cctcattgcc
     2041 cgggcatcag ggctgctcca tgagagattg gatgagtttg aattacaggg cccagctctt
     2101 accaccttca actttgaccg caacaaagtg cttgccttca ggcagcttgc tgctgaaaat
     2161 aaatacgggt tgatggacac aatgaaagtt gggaggcagc tcaaggatgt caaaaccatg
     2221 ccagaactta aacaagcact caagaacacc tcaatcaaga agtgccagat tgtgtatagt
     2281 ggttgcacct acacacttga gtctgatggc aagggcaatg tgaaagttga cagagttcag
     2341 agcacctccg ttcagaccaa caatgagctg gctggcgccc tgcaccacct aaggtgcgcc
     2401 agaatcaggt actatgtcaa gtgtgttcag gaggccctgt attctatcat ccagattgct
     2461 ggggctgcat ttgtcaccac gcgcatcatc aagcgtgtga acattcaaga cttatggtcc
     2521 aagccacaag tggaaaacac agaggaggcc accaacaagg acgggtgccc aaaacccaaa
     2581 gataatgagg agttcgtcat ttcatctgac gacattaaaa ctgagggcaa gaaagggaag
     2641 aacaagactg gccgtggcaa gaagcacaca gccttctcaa gtaaaggtct cagtgatgaa
     2701 gagtatgatg agtacaagag aattagagag gaaaggaatg gtaagtactc tatagaagag
     2761 taccttcagg acagggacag atactatgag gaggtggcca ttgccagggc gaccgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcagacc aacaaggaaa
     2881 caacgcaagg aagaaagagc ttccctcggt ttagtcacag gttctgaaat taggaaaagg
     2941 aacccagacg acttcaagcc taaggggaaa ctatgggctg atgatgacag aagtgtggac
     3001 tacaatgaaa aactcagttt tgaggccccg ccaagcatct ggtcaaggat agtcaacttt
     3061 ggctcaggtt ggggcttctg ggtctccccc agcctgttta taacatcaac ccacgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt acacaagtca
     3181 ggcgaattct gtcgcttgag gttcccaaaa ccaatcagga ctgatgtggc tggcatgatc
     3241 ttggaagaag gtgcgcccga aggcaccgtg gtcacactac tcatcaaaag gtctactgga
     3301 gaacttatgc ccctagcagc tagaatgggg acccatgcaa ccatgaagat tcaagggcgc
     3361 actgttggag gtcagatggg catgctccta acaggatcca acgccaaaag catggatcta
     3421 ggcaccacac caggtgattg cggctgtccc tacatctata agagaggaaa tgactatgta
     3481 gtcattggag tccacacggc tgccgctcgt gggggaaaca ctgtcatatg tgccacccaa
     3541 gggggtgagg gggaagctac acttgaaggt ggtgacagta agggaacata ctgtggcgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca aaaccaaatt ctggagatca
     3661 tccacagcac cactcccacc cggcacctat gaaccagcct accttggtgg caaggacccc
     3721 agagtcaagg gtggcccctc gttgcagcaa gttatgaggg accagctgaa accatttaca
     3781 gagcctaggg gcaagccacc aaagccaagt gtgttagaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaagtggt cgttcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggaat ctttcacagg caagctggca gaccaggctt ctaaggccaa cctgatgttt
     4021 gaagaaggga agaacatgac cccagtctac acaggtgcac ttaaggatga attagttaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttggcaacc
     4141 atgatccggt gtgctcgagc attcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acactcccta tcagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagaag
     4261 cattccaggt acagatacca ctatgatgct gattactctc ggtgggattc aacacaacag
     4321 agagccgtgc tggcagctgc tctagaaatc atggttaaat tctcctcaga accacatttg
     4381 gctcaggtag tagcagaaga ccttctttct cctagcgtgg tggacgtggg tgacttcaca
     4441 atatcaatca acgagggtct cccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc tcctcactct ctgtgcactc tccgaagtta caaatttgtc cccagacatc
     4561 atacaggcta attctctctt ctccttctat ggtgatgatg aaattgttag tacagacata
     4621 aaattagacc cagagaagtt gacagcaaag cttaaggaat acgggttgaa accaacccgc
     4681 cctgataaaa ctgaaggacc tcttgttatt tctgaagact tagatggctt gaccttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatgaag atccatctga atcaatgatt
     4861 ccacactctc aaagacccat acaattgatg tccttactgg gagaggccgc actccacggc
     4921 ccaacattct acagtaaggt cagcaaatta gtcattgcag agttaaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggaag gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtctaacga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgtcg gtgccgctat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atttgaaccc
     5341 ctacctatct catttggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gatcctcgcg gggaacgcgt tcaccgccgg aaaaattata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttga gtcccagcca ggtcactatg ttcccccata taatagtgga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacctgat gttaggaata atttctatca
     5581 ttataatcag tcaaatgatt ctactattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtcttcac agtctcttgt cgagtcctca cgaggccatc
     5701 ccctgatttt gattttatat ttttggtgcc acctacagtt gagtcaagaa ctaaaccatt
     5761 tactgtccca atcttaactg ttgaagaaat gaccaattca agattcccca ttcctttgga
     5821 gaaattgttc acgggtccca gcggtgcctt tgttgttcaa ccgcaaaatg gcagatgcac
     5881 gactgatggc gtgctcctag gcaccaccca actgtctcct gtcaacattt gcaccttcaa
     5941 aggggatgtc acccacattg caggttctcg taattacaca atgaatttgg cttctctaaa
     6001 ttggaacaat tatgacccaa cagaagaaat tccagcccct ctaggaactc cagatttcgt
     6061 gggaaagatc caaggtgtgc tcactcaaac cacaaaggga gatggttcga cccgtggcca
     6121 caaagctaca gtctacactg ggagtgctcc ctttactcca aagctgggca gtgttcaatt
     6181 cagtactgat acagaaaatg attttgaaac tcaccaaaac acaaaattca ccccagtcgg
     6241 tgtcatccag gatggtggca ccacccatca aaatgaaccc caacaatggg tgctcccaag
     6301 ttattcaggt agagatgtcc ctaatgtaca cctagcccct gctgtggccc ccactttccc
     6361 gggtgaacaa cttcttttct ttaggtccac catgcccgga tgcagcgggt atcccaacat
     6421 gaatttggac tgcctactcc cccaggagtg ggtgcagcac ttctaccaag aggcagctcc
     6481 agcacaatct gatgtggctt tattgagatt tgtgaatcca gacacgggta gggtcctgtt
     6541 tgagtgcaaa cttcataaat caggctatgt cacagtggct cacaccggcc agcatgatct
     6601 ggtcatcccc cccaatggtt attttaggtt tgattcctgg gttaatcaat tctacacact
     6661 cgcccccatg ggaaatggaa cggggcgtag acgtgcttta taatggctgg agctttcttt
     6721 gctgggttgg catctgatgt ccttagctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggctatca accaaaaggt tgattttgag aataacagaa aattgcagca agcttccttc
     6841 cagtttagca gtaatctaca acaggcttcc tttcaacatg ataaagaaat gctccaagca
     6901 caaattgagg ccactagaaa gttgcaacag gaaatgatga aagtcaaaca ggcaatgctc
     6961 ttagaaggtg gattctctga aacagatgca gcccgtgggg caatcaacgc ccctatgaca
     7021 aaggctttgg actggagcgg aacaaggtac tgggcccctg atgctaggac tacaacatac
     7081 aacgcaggcc gtttttccac ccctcaacct tcgggggtac tgccaggaag aaccaatccc
     7141 aggactccta cccccgcccg gggctccccc agcacatctt ctaatgcttc tactgctact
     7201 tctatatatt caaatcaaac tgtttcaacg agacttggtt ctacagctgg ttctggcacc
     7261 aatgtctcga gtctcccgtc aactgcaagg actaggagtt gggttgaggg tcaaaacaga
     7321 aatttgtcac ctttcatgag gggggctcac aatatatcgt ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca tacgtaggcg aggggagtca
     7501 cgggtgtaa
//