Typing tool

Complete norovirus genomes

AB933685  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5097
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933685                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Ehime3/2010/JP genomic RNA, complete genome.
ACCESSION   AB933685
VERSION     AB933685.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Ehime3/2010/JP
  ORGANISM  Norovirus Hu/GII.4/Ehime3/2010/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Ehime3/2010/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Ehime3/2010/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498679"
                     /country="Japan:Ehime"
                     /collection_date="2010"
     CDS             1..5097
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30115.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     FAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEAANEDGC
                     PKPKDNEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVAGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVMDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGV"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30116.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRDYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVRFSTDTENDFEIHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRDAHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30117.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGAPPGRTNPRTPTPARGSPSTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTNISSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc ccccccgagg gagataccac aaagaccccc acgaccacct
      181 actccagaac tggtcaaaaa gatccctcct cccccgccca acggagagga tgaagtagtg
      241 gtttcttata gtgccaaaga tggcgtttcc ggtttgcctg agctttccac tgtcaggcag
      301 ccggaagaaa ccaatacggc cttcagtgtc cctccactca atcagaggga gaacagggat
      361 gctaaggaac cactgactgg aacaattctg gaaatgtggg atggagaaat ttaccattat
      421 ggcctgtatg ttgagcgagg tcttgtgctg ggtgtgcaca aaccaccagc tgccattagc
      481 ttcgccaagg tcgaactaac accactctcc ttgttctgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttacacggag aaacatttcc ctacacagcc
      601 ttcgacaaca attgctatgc cttttgttgc tgggtcctgg acctaaacga ctcgtggctg
      661 agtaggagaa tgatccagag aacaactggt ttcttcagac cctaccaaga ttggaatagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagctaacat attcctgtgc
      781 accctgtctt cgctattcac caggcccata aaagacataa tagggaagtt aaggcctctc
      841 aacatcatca acatcctggc ttcatgtgat tggactttcg caggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgattt cgagttacaa ggacctgagg accttgtagt ggagctcgtc
     1021 cctgtagtaa tggggggaat tggtttggtg ctaggattca ccaaagagaa gattggaaaa
     1081 atgttgtcat ctgctgcatc taccttgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttagtcat gaagtggttc ttcccgaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagta ctggaccttg aggcaattga aaacaatcat
     1261 atgaccacct tgctcaaaga caaagacagc ctggcaacct atatgagaac ccttgacctc
     1321 gaggaagaga aagccagaaa actctcaacc aagtctgctt cacctgacat cgtgggcaca
     1381 attaacgccc ttctggcgag aattgccgct gcacgctccc tggtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag acctgtagtc ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag aaaatcgcag cctccctcac aggagaccag
     1561 cgtgtaggcc tcatcccacg caatggcgtc gatcactggg atgcgtacaa gggggagagg
     1621 gttgtcctat gggacgacta tggaatgagt aatcccatcc acgacgccct caggctgcaa
     1681 gaacttgctg acacttgccc cctcactcta aattgtgaca ggattgagaa taaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcact actaacttgg ctaacccagc accactggac
     1801 tatgtcaact ttgaagcatg ctcgaggcgc atcgacttcc tcgtgtatgc agaagccccc
     1861 gaggtcgaaa aggcgaagcg tgacttcccg ggccaacctg acatgtggaa aaacgctttt
     1921 agtcctgatt tctcacacat aaaattggca ctggctccac aaggtggctt tgataagaac
     1981 gggaacaccc cacacgggaa gggcgtcatg aagactctca ccactggctc cctcattgcc
     2041 cgggcatcag ggctgctcca tgagagattg gatgagtttg aactacaggg cccagctctt
     2101 accaccttca actttgaccg caacaaagtg cttgccttca gacagcttgc tgctgaaaac
     2161 aaatacgggt tgatggatac aatgaaagtt gggaggcagc tcaaggatgt caaaaccatg
     2221 ccagaactta aacaagcact caagaatatc tcaatcaaga agtgccagat tgtgtatagt
     2281 ggttgcacct acacacttga gtctgatggc aagggcaatg tgaaagttga cagagttcag
     2341 agcacctccg ttcagaccaa caatgagctg gctggcgccc tgcaccatct aaggtgcgcc
     2401 agaatcaggt actatgtcaa gtgtgttcag gaggccctgt attctatcat ccaaattgct
     2461 ggggctgcat ttgtcaccac gcgcatcatc aagcgtgtga acattcagga cttgtggtcc
     2521 aagccacaag tggaaaacac agaggaggct gccaacgagg acgggtgccc aaagcccaaa
     2581 gataatgagg agttcgtcat ttcatctgac gacattaaaa ctgagggtaa gaaagggaag
     2641 aacaagactg gccgtggcaa gaagcacaca gccttctcaa gtaaaggtct cagtgatgaa
     2701 gagtatgatg agtacaagag aattagagag gagaggaatg gcaagtactc catagaagag
     2761 taccttcagg acagggacaa atactatgag gaggtggcca ttgccagggc gaccgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcagacc aacaaggaaa
     2881 caacgcaagg aagaaagggc ttctctcggt ttagtcacag gttctgaaat taggaaaagg
     2941 aacccagaag acttcaagcc taaggggaaa ctatgggctg acgatgacag aagtgtggac
     3001 tacaatgaaa aactcagctt tgaggcccca ccaagcatct ggtcaaggat agtcaacttt
     3061 ggctcaggtt ggggcttctg ggtctccccc agcctgttca taacatcaac ccacgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt acacaagtca
     3181 ggcgaattct gtcgcttgag gttcccaaaa ccaatcagga ctgatgtggc tggcatgatc
     3241 ttggaagaag gtgcgcccga aggcaccgtg gtcacactac tcatcaaaag gtctactgga
     3301 gaactcatgc ccctagcagc tagaatgggg acccatgcaa ccatgaaaat tcaaggacgc
     3361 actgttggag gccagatggg catgcttctg acaggatcca acgccaaaag catggaccta
     3421 ggcaccacac caggtgattg cggctgtccc tacatttaca agagagggaa tgactatgtg
     3481 gtcattgggg tccacacggc tgccgctcgt gggggaaaca ctgtcatatg tgccacccag
     3541 gggggtgagg gggaagctac acttgaaggt ggtgacagta agggaacata ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca aaaccaaatt ctggagatca
     3661 tccacagcac cactcccacc tggcacctat gaaccagcct accttggtgg caaggacccc
     3721 agagtcaagg atggcccctc tctgcagcaa gtcatgaggg accagctgaa accatttaca
     3781 gaacctaggg gtaagccacc aaagccaagc gtgttggaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaagtggt cgttcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggaat ccttcacagg caagctggca gaccaggctt ccaaggccaa cttgatgttt
     4021 gaagaaggga agaacatgac cccagtctac acaggtgcac ttaaggatga gttagtcaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttggcaacc
     4141 atgatccggt gtgctcgagc attcggaggt ctaatggatg aactcaaagc acactgtgtc
     4201 acacttccta tcagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagaag
     4261 cattccaggt acagatacca ctatgatgct gattactctc ggtgggattc aacacaacag
     4321 agagccgtgc tggcagctgc tctagaaatc atggttaaat tctcctcaga accacacttg
     4381 gcccaggtgg tagcagaaga ccttctttct cctagcgtga tggatgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcactct ctgtgcactc tccgaagtta caaatttgtc cccagacatc
     4561 atacaggcta actctctctt ctccttctat ggtgatgatg aaattgttag tacagacata
     4621 aaattagacc cagagaagtt gacagcaaag cttaaggaat acgggttgaa accaacccgc
     4681 cctgacaaaa ctgaaggacc tcttgttatc tctgaagact tggatggttt gactttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggaaca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatgaag atccatctga atcaatgatt
     4861 ccacactctc aaagacccat acaattgatg tccttactgg gagaggccgc actccacggc
     4921 ccaacattct acagtaaaat cagcaaatta gtcattgcag agctaaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtctaatga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctctggag cccgttgtcg gtgccgctat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atctgaatcc
     5341 ctacctatct catttggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gatcctcgcg gggaacgcgt tcaccgccgg aaaaattata tttgcagcag tcccaccaaa
     5461 cttcccaact gaaggcctga gtcccagcca ggttactatg ttcccccaca taatagtgga
     5521 tgttaggcaa ttggaacctg tattgatccc cttacctgat gttaggaata acttttatca
     5581 ttataatcag tcaaatgatt ctaccattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtcttcac agtttcttgt cgagttctca cgaggccatc
     5701 ccctgatttt gattttatat ttttggtgcc acctacagtt gagtcaagaa ctaaaccatt
     5761 tactgtccca atcttaactg ttgaagaaat gaccaattca agattcccca ttcctttgga
     5821 aaaattgttc acgggcccca gcagtgcctt tgttgttcaa ccacaaaatg gcagatgcac
     5881 gactgatggc gtgctcttag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccacattg caggttctcg tgattacaca atgaatttgg cttctctaaa
     6001 ttggaacaat tatgacccaa cagaagaaat tccagcccct ttaggaaccc cagatttcgt
     6061 gggaaagatc caaggtatgc tcactcaaac tacaaaggga gatggctcga cccgtggcca
     6121 taaagctaca gtttacactg ggagtgcccc ctttactcca aagctgggca gtgttcggtt
     6181 cagtactgac acagaaaatg attttgaaat tcaccaaaat acaaaattca ctccagtcgg
     6241 tgtcatccag gatggtagca ccacccaccg aaatgaaccc caacaatggg tactcccaag
     6301 ttattcaggt agagatgccc ataatgtaca cctagcccct gctgtagccc ccacttttcc
     6361 gggtgaacaa cttcttttct tcaggtccac tatgcccgga tgcagcgggt atcccaacat
     6421 ggatttggat tgcctgctcc cccaggagtg ggtgcagcac ttctaccaag aggcagctcc
     6481 agcacaatct gatgtggctc tattgagatt tgtgaatcca gacacgggta gggttctgtt
     6541 tgagtgcaaa ctccataaat caggctatgt cacagtggct cacaccggcc agcatgattt
     6601 ggtcatcccc cccaatggtt attttaggtt tgattcctgg gttaatcaat tctatacact
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcttta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttagctct ggacttggtt ccctgatcaa tgctggggct
     6781 ggggctatca accaaaagat tgattttgaa aataacagaa aattgcagca agcttccttc
     6841 cagtttagca gtaatctaca acaggcttcc tttcaacacg ataaagagat gctccaagca
     6901 caaattgagg ccactaaaaa gttgcaacag gaaatgatga aagtcaaaca ggcaatgctc
     6961 ttagaaggtg gattctctga aacagatgcg gcccgtgggg caatcaacgc ccctatgaca
     7021 aaggctttgg attggagcgg aacaaggtac tgggcccctg atgctaggac tacaacatac
     7081 aatgcaggcc gtttttccac ccctcaacct tcgggggcac cgccaggaag aaccaaccct
     7141 aggactccaa cccccgctcg gggctccccc agcacatctt ctaatgcttc tactgctact
     7201 tctatatatt caaatcaaac tgtttcaacg agacttggtt ctacagctgg ttctggcacc
     7261 aacatctcga gtctcccgtc aactgcaagg actaggagtt gggttgagga tcaaaacaga
     7321 aatttgtcac ctttcatgag gggggctcac aacatatcgt ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcgacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca atacgcgcag gcagcctctc ttcgctcaca ttcgtaggcg aggggagtca
     7501 cgggtgtaa
//