Typing tool

Complete norovirus genomes

AB933676  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,506 | 3 CDS

ORF1: 1..5094
ORF2: 5078..6700
ORF3: 6700..7506
LOCUS       AB933676                7506 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Niigata2/2010/JP genomic RNA, complete genome.
ACCESSION   AB933676
VERSION     AB933676.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Niigata2/2010/JP
  ORGANISM  Norovirus Hu/GII.4/Niigata2/2010/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7506)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7506
                     /organism="Norovirus Hu/GII.4/Niigata2/2010/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Niigata2/2010/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498670"
                     /country="Japan:Niigata"
                     /collection_date="2010"
     CDS             1..5094
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS30088.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     QPPPREIPQRPPRPPTPELIKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPEE
                     TNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAISL
                     AKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDSW
                     LSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGKL
                     RPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPEDL
                     VVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFPK
                     KEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLSTK
                     SASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREVA
                     KRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTCP
                     LTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEKA
                     KRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARAS
                     GLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTMP
                     ELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLRC
                     ARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGCP
                     KPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLVT
                     GSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSPS
                     LFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEGT
                     VVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDC
                     GCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILGP
                     GSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCWN
                     GESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLA
                     TMVRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWDS
                     TQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKE
                     YGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPN
                     HEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPSFVNEDGV"
     CDS             5078..6700
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS30089.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVSICTFRGDVTHIAGSRDYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     STAHRNEPQQWVLPSYSGRNVQNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6700..7506
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30090.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQVQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRNNPRTPTPARGSPSTSS
                     SAFTATSIYSNQTVSTRLGSTAGSGTNVSSPPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcgtc ctcagccccc cccgagggaa ataccacaaa gacccccacg accacctact
      181 ccagaactga tcaaaaagat ccctcctccc ccgcccaacg gagaggatga agtagtggtt
      241 tcttatagtg ccaaagatgg cgtttccggt ttacctgagc tttccaccgt cagacaaccg
      301 gaagaaacca atacggcctt cagtgtccct ccactcaatc agagggagaa tagggatgct
      361 aaggaaccac tgactggaac aatcctggaa atgtgggatg gagaaatcta ccattatggc
      421 ctgtatgttg agcgaggtct tgtgctgggt gtgcacaaac caccagctgc cattagcctc
      481 gccaaggtcg aactaacacc actctccttg ttctggagac ctgtgtacac tcctcagtac
      541 ctcatctctc cggacactct caagaaatta cacggagaaa cattccccta cacagccttc
      601 gacaacaatt gctatgcctt ttgttgctgg gtcctggacc taaacgactc gtggctgagt
      661 aggagaatga tccagagaac aactggcttc ttcagaccct accaagattg gaataggaaa
      721 cccctcccca ctatggatga ttccaaattg aagaaggtag ctaacatatt cctgtgcacc
      781 ctgtcttcgc tatttactag gcccataaaa gacataatag ggaagttaag gcctctcaac
      841 atcatcaaca tcctggcttc atgtgattgg actttcgcag gcatagtgga gtccttgata
      901 ctcttggcag agctctttgg agtcttctgg acacccccag atgtgtctgc gatgattgcc
      961 cccttactcg gtgatttcga gttacaagga cctgaggacc ttgtagtaga gctcgtccct
     1021 gtagtaatgg ggggaattgg tttggtgcta ggattcacca aagagaagat tggaaaaatg
     1081 ttgtcatctg ccgcatctac cttgagagct tgtaaagatc ttggtgcgta tgggctagag
     1141 atcctaaaat tagtcatgaa gtggtttttc ccgaagaaag aggaagcaaa tgaactggct
     1201 atggtgagat ccatcgagga tgcagtactg gaccttgagg caattgaaaa caaccatatg
     1261 accaccttgc tcaaagacaa agacagcctg gcaacatata tgagaaccct tgacctcgag
     1321 gaagagaaag ccagaaaact ctcaaccaag tctgcttcac ccgacatcgt gggcacaatc
     1381 aacgcccttc tggcgagaat cgccgctgca cgctccctgg tgcaccgagc gaaggaggag
     1441 ctttccagca gaccaagacc tgtagtcttg atgatatcag gcagaccagg aatagggaag
     1501 acccaccttg ctagggaagt ggctaagaga atcgcagcct ccctcacagg agaccagcgt
     1561 gtaggcctca tcccacgcaa tggcgtcgat cactgggatg cgtacaaggg ggagagggtc
     1621 gtcctatggg acgactatgg aatgagcaat cccatccacg acgccctcag gctgcaagaa
     1681 ctcgctgaca cttgccccct cactctaaat tgtgacagga ttgagaataa aggaaaggtc
     1741 ttcgacagcg atgtcattat catcactact aacctggcca acccagcacc actggactat
     1801 gtcaactttg aagcgtgctc gaggcgcatc gatttcctcg tgtatgcaga agcccccgag
     1861 gtcgaaaagg caaagcgtga cttcccgggc caacctgata tgtggaaaaa cgctttcagt
     1921 tctgatttct cacacataaa attggcactg gctccacaag gtggttttga taagaacggg
     1981 aacaccccac acgggaaggg cgtcatgaag actctcacca ctggctccct cattgcccga
     2041 gcatcagggc tgctccatga gaggttggat gagtttgaac tacagggccc agctcttacc
     2101 accttcaact ttgaccgcaa caaagtgctt gcctttaggc agcttgctgc tgaaaacaaa
     2161 tacgggttga tggacacaat gaaagttggg aggcagctca aggatgtcaa aaccatgcca
     2221 gaacttaaac aagcactcaa gaatatctca atcaagaagt gccagattgt gtatagtggt
     2281 tgcacctaca cacttgagtc tgatggcaag ggcaatgtga aagttgacag agttcagagc
     2341 acctccgttc agaccaacaa tgagctggct ggcgccctgc accatttaag gtgcgccaga
     2401 atcaggtact atgtcaagtg tgttcaggag gccctgtatt ctatcatcca gattgctggg
     2461 gctgcatttg tcaccacgcg catcattaag cgcgtgaaca ttcaagactt gtggtccaag
     2521 ccacaagtgg aaaacacaga ggaggccacc aacaaggacg ggtgcccaaa acccaaagat
     2581 gatgaggagt tcgtcatttc atctgacgac attaaaactg agggtaagaa agggaagaac
     2641 aagactggcc gtggcaagaa gcacacagcc ttctcaagta aaggtctcag tgatgaagag
     2701 tatgatgagt acaagagaat tagagaggaa aggaatggca agtactccat agaagagtac
     2761 cttcaggaca gggacaaata ctatgaggag gtggccattg ccagggcgac cgaggaagac
     2821 ttctgtgaag aggaggaggc caagatccgg caaaggatct tcagaccaac aaggaaacaa
     2881 cgcaaggaag aaagagcttc tctcggttta gtcacaggtt ctgaaattag gaagaggaac
     2941 ccagaagact tcaagcctaa ggggaaacta tgggctgacg atgacagaag tgtggactac
     3001 aatgaaaaac tcagctttga ggccccacca agcatctggt caaggatagt caactttggc
     3061 tcaggttggg gcttctgggt ctcccccagc ctgttcataa catcaaccca cgtcataccc
     3121 cagggcgcaa aggagttctt tggagtcccc atcaaacaaa ttcaggtaca caagtcaggc
     3181 gaattctgtc gcttgaggtt cccaaagcca atcaggactg atgtaactgg catgatcttg
     3241 gaagaaggtg cgcccgaagg caccgtggtc acactactca tcaaaaggtc tactggagaa
     3301 ctcatgcccc tagcagctag gatggggacc catgcaacca tgaaaattca agggcgcact
     3361 gttggaggtc agatgggcat gcttctgaca ggatccaacg ccaaaagcat ggatctgggc
     3421 accacaccag gtgattgcgg ctgtccctac atctacaaga gaggaaatga ctatgtggtc
     3481 attggagtcc acacggctgc cgctcgtggg ggaaacactg tcatatgtgc cacccaggga
     3541 ggtgaggggg aagctacact tgaaggtggt gacagtaagg gaacatactg tggtgcacca
     3601 atcctaggcc cagggagtgc cccaaaactt agcaccaaaa ccaaattctg gagatcatcc
     3661 acagcaccac tcccacctgg cacctatgaa ccagcctacc ttggtggcaa ggaccccaga
     3721 gtcaagggtg gcccctcgtt gcagcaagtc atgagggacc agctgaaacc atttacagag
     3781 cctaggggta agccaccaaa gccaagtgtg ttagaagctg ccaagaaaac catcatcaat
     3841 gtccttgaac aaacaattga cccacctgag aagtggtcgt tcgcacaagc ttgcgcgtcc
     3901 cttgacaaga ccacttctag cggccatccg caccacatgc ggaaaaacga ctgctggaac
     3961 ggggaatcct tcacaggcaa gctggcagac caggcttcta aggccaacct gatgtttgaa
     4021 gaagggaaga acatgacccc agtctacaca ggtgcactta aggatgaatt agtcaaaact
     4081 gacaagattt atggtaagat caagaagagg cttctctggg gctcggattt ggcaaccatg
     4141 gtccggtgtg ctcgagcatt cggaggccta atggatgaac tcaaagcaca ctgtgtcaca
     4201 cttcctatca gagttggtat gaatatgaat gaggatggcc ccatcatctt cgagaagcat
     4261 tccaggtaca ggtaccacta tgatgctgat tactctcggt gggattcaac acaacagaga
     4321 gccgtgctgg cagccgctct agaaatcatg gttaaattct cctcagaacc acatttggct
     4381 caggtagtag cagaagacct tctttctcct agcgtggtgg atgtgggtga cttcacaata
     4441 tcaatcaatg agggcctccc ctctggggtg ccctgcacct cccaatggaa ctccatcgcc
     4501 cactggcttc tcactctctg tgcactctcc gaagttacaa atttgtcccc agacatcata
     4561 caggctaatt ctctcttctc cttctatggt gatgatgaaa ttgttagtac agacataaaa
     4621 ttggacccag agaagttgac agcaaagctt aaggaatacg ggctgaaacc aacccgccct
     4681 gataaaactg aaggacctct tgttatttct gaagacttag atggtttgac tttcctgcgg
     4741 agaactgtga cccgcgaccc agctggttgg tttggaaaac tggagcagag ttcaatactc
     4801 aggcaaatgt actggactag gggccccaac catgaagatc catctgaatc aatgattcca
     4861 cactctcaaa gacccataca attgatgtcc ttactgggag aggccgcact ccacggccca
     4921 acattctaca gcaaaatcag caaattagtc attgcagaac taaaagaagg tggtatggat
     4981 ttttacgtgc ccaggcaaga gccaatgttc agatggatga gattctcaga tctgagcacg
     5041 tgggagggcg atcgcaatct ggctcccagt tttgtgaatg aagatggcgt ctaatgacgc
     5101 caacccatct gatgggtccg cagccaacct cgtcccagag gtcaacaatg aggttatggc
     5161 tttggagccc gttgtcggtg ccgctattgc ggcgcctgta gcgggccaac aaaatgtgat
     5221 tgacccctgg attagaaata attttgtaca agcccctggt ggagaattca cagtatcccc
     5281 tagaaatgct ccaggtgaaa tactatggag cgcgccctta ggccctgatc tgaatcccta
     5341 cctatcccat ttggccagaa tgtataatgg ttatgcaggt ggttttgaag tgcaggtgat
     5401 cctcgcgggg aacgcgttca ccgccggaaa aattatattt gcagctgtcc caccaaattt
     5461 tccaactgaa ggcttgagtc ccagccaggt cactatgttt ccccacataa tagtggatgt
     5521 taggcaattg gaacctgtgt tgatcccctt acctgatgtt aggaataact tctaccacta
     5581 taatcagtca aatgattcta ccattaaatt gatagcaatg ctgtatacac cacttagggc
     5641 taataatgct ggggatgatg tcttcacagt ctcttgtcga gtcctcacga ggccatcccc
     5701 tgattttgac tttatatttt tggtgccacc tacagttgag tcaagaacta aaccatttac
     5761 tgtcccaatc ttaactgttg aagaaatgac caattcaaga ttccccattc ctttggaaaa
     5821 attgtttacg ggtcccagca gtgcctttgt tgttcaacca caaaatggca gatgcacgac
     5881 tgatggcgtg ctcttaggca ccacccaact gtctcctgtc agcatctgca ccttcagagg
     5941 ggatgtcacc cacattgcag gttctcgtga ttacacaatg aatttggctt ctctaaattg
     6001 gaacaactat gacccaacag aagaaattcc agcccctcta ggaaccccag atttcgtggg
     6061 aaagatccaa ggtgtgctca ctcaaaccac aaagggagat ggttcgaccc gtggccataa
     6121 agctacagtt tacactggga gtgccccctt tactccaaag ctgggcagtg ttcaattcag
     6181 tactgataca gaaaatgatt ttgaaactca ccaaaacaca aaattcaccc cagtcggtgt
     6241 catccaggat ggtagcaccg cccaccgaaa tgaaccccaa caatgggtgc tcccaagtta
     6301 ttcaggtaga aatgtccaaa atgtacacct agcccctgct gtagccccca cgtttccggg
     6361 tgaacaactt cttttcttta ggtccactat gcccggatgc agcgggtatc ccaacatgga
     6421 tttggattgc ctactccccc aggagtgggt gcagcacttc taccaagagg cagctccagc
     6481 acaatctgat gtggctctat tgagatttgt gaatccagac acgggtaggg tcctgtttga
     6541 gtgcaagctt cataaatcag gctatgtcac agtggcccac accggccagc atgatttggt
     6601 catccccccc aatggttatt ttaggtttga ttcctgggtt aatcaattct acacacttgc
     6661 ccccatggga aatggaacgg ggcgtagacg tgctttataa tggctggagc tttctttgct
     6721 ggattggcat ctgatgtcct tagctctgga cttggttccc taatcaatgc tggggctggg
     6781 gctatcaacc aaaagatcga ttttgaaaat aacagaaaat tgcagcaagc ttccttccag
     6841 tttagcagta atctacaaca ggcttccttt caacatgata aagagatgct ccaagtacaa
     6901 attgaggcca ctaaaaagtt gcaacaggaa atgatgaaag ttaaacaggc aatgctttta
     6961 gaaggtggat tctctgaaac agatgcagcc cgtggggcaa ttaacgcccc tatgacaaag
     7021 gctttggact ggagcgggac aaggtactgg gcccctgatg ctaggactac aacatacaat
     7081 gcaggccgtt tttccacccc tcaaccttcg ggggcactgc caggaagaaa caatcctagg
     7141 actcctaccc ccgctcgggg ctcccccagc acatcttcta gtgcttttac tgctacttct
     7201 atatattcaa atcaaacagt ttcaacgaga cttggttcta cagcaggttc tggcaccaat
     7261 gtctcgagtc ccccgtcaac tgcaaggact aggagttggg ttgaggatca aaacagaaat
     7321 ttgtcacctt tcatgagggg ggctcacaac atatcgtttg tcaccccacc atctagcaga
     7381 tcctctagcc aaggcacagt ctcaaccgtg cctaaagaag ttttggactc ctggactggc
     7441 gctttcaaca cgcgcaggca gcctctcttc gctcacattc gtaggcgagg ggagtcacgg
     7501 gtgtaa
//