Typing tool

Complete norovirus genomes

AB933646  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       AB933646                7509 bp    RNA     linear   VRL 02-SEP-2015
DEFINITION  Norovirus Hu/GII.4/Shimane1/2009/JP genomic RNA, complete genome.
ACCESSION   AB933646
VERSION     AB933646.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Shimane1/2009/JP
  ORGANISM  Norovirus Hu/GII.4/Shimane1/2009/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Sato,H., Yokoyama,M. and Motomura,K.
  TITLE     Identification of strong evolutionary constraints on viral capsid
            protein during divergent evolution of a norovirus pandemic lineage
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Sato,H., Nakamura,H. and Motomura,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-MAY-2014) Contact:Kazushi Motomura National Institute
            of Infectious Diseases, Pathogen Genomics Center; Gakuen 4-7-1,
            Musashi-Murayama, Tokyo 208-0011, Japan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII.4/Shimane1/2009/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Shimane1/2009/JP"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1498640"
                     /country="Japan:Shimane"
                     /collection_date="2009"
     CDS             1..5100
                     /note="contains N-terminal, NTPase, 3A, VPg, 3Cpro and
                     3Dpol"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAS29998.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSVAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSVKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGKPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVHNGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDIEEFVISSDDIKAEGKKGKNKAGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKNGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAS29999.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRDYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSEVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAS30000.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEVMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRINPRTPTPARGSPSTSS
                     NASTAASIYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcgtggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaaacagcc ccccccgagg gaaataccac aaagaccccc acgaccacct
      181 actccagaac tggtcaaaaa gatccctcct cccccgccca acggggagga tgaagtagtg
      241 gtttcttata gtgttaaaga tggcgtttcc ggtttacctg agctttccac cgtcaggcaa
      301 ccggaagaaa ccaatacggc cttcagtgtc cctccactca atcagaggga gaatagggat
      361 gctaaggaac cactgactgg aacaattctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctgtatg ttgagcgagg tcttgtgcta ggtgtgcaca aacccccagc tgccattagc
      481 ctcgccaagg tcgaactaac accactctcc ttgttctgga ggcctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttacacggag aaacattccc ctacacagcc
      601 ttcgacaaca attgctatgc cttttgttgc tgggtcctgg atctaaacga ctcgtggctg
      661 agtaggagaa tgatccagag aacaactggc tttttcagac cctaccaaga ttggaatagg
      721 aagcccctcc ccactatgga tgattccaaa ttaaagaagg tagctaatat attcctgtgc
      781 accctgtctt cgctatttac caggcccata aaagacataa taggaaagtt aaggcctctc
      841 aacatcatca acatcctggc ttcatgtgat tggactttcg caggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacgcccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgattt cgagttacaa ggacctgagg accttgtagt ggagctcgtc
     1021 cctgtagtaa tggggggaat tggtttggtg ctaggattca ccaaagagaa gattggaaaa
     1081 atgttgtcat ctgctgcatc taccttgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttagtcat gaagtggttc ttcccgaaga aagaggaagc aaatgaactg
     1201 gctatggtga gatccatcga ggatgcagta ctggatcttg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagatagc ctggcaacct atatgagaac ccttgacctc
     1321 gaggaagaga aagccagaaa actctcaacc aaatctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgccgct gcacgctccc tggtgcaccg agcgaaggag
     1441 gagctttcca gcagaccaag acctgtagtc ttgatgatat caggcaaacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctccctcac aggagaccag
     1561 cgtgttggcc tcatcccacg caatggcgtc gatcactggg atgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgacta tggaatgagc aatcccatcc acgacgccct caggctgcaa
     1681 gaactcgctg acacttgccc cctcactcta aattgtgaca ggattgagaa caaaggaaag
     1741 gtctttgaca gcgatgtcat catcatcact actaacctgg ccaacccagc accactggac
     1801 tatgtcaact ttgaagcgtg ctcgaggcgt atcgatttcc tcgtgtatgc agaagccccc
     1861 gaggtcgaaa aggcgaagcg tgacttcccg ggccaacctg acatgtggaa aaacgctttt
     1921 agttctgatt tctcacacat aaaattggca ctggctccgc aaggtggctt tgataagaac
     1981 gggaacaccc cacacgggaa gggcgtcatg aagactctca ccactggctc cctcattgcc
     2041 cgggcatcag ggctgctcca cgagagattg gatgagtttg aactacaggg cccagctctc
     2101 accaccttca actttgaccg caacaaagtg cttgccttca ggcagcttgc tgctgaaaac
     2161 aaatacgggt tgatggacac aatgaaagtt gggagacagc tcaaggatgt caaaaccatg
     2221 ccagaactta aacaagcact caagaatatc tcaatcaaga agtgccagat tgtgcataat
     2281 ggctgcacct acacacttga gtctgatggt aagggcaatg tgaaagttga cagagttcag
     2341 agcacctccg ttcagaccaa caatgagctg gctggcgccc tgcaccatct aaggtgcgcc
     2401 agaatcaggt attatgtcaa gtgtgtccag gaggccctgt attccatcat ccagattgct
     2461 ggggctgcat ttgtcaccac gcgcatcatc aagcgtgtga acattcaaga cttatggtcc
     2521 aaaccacaag tggaaaacac agaggaggct accaacaagg acgggtgccc aaaacccaaa
     2581 gatattgagg agttcgtcat ttcatctgac gacattaaag ctgagggtaa gaaagggaag
     2641 aacaaggctg gccgtggcaa gaagcacaca gccttctcaa gtaaaggcct cagtgatgaa
     2701 gagtatgatg agtacaagag aattagagag gaaaggaatg gcaagtactc tatagaagag
     2761 tacctacagg acagggacaa atactacgag gaggtggcca ttgccagggc gaccgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcagacc aacaaggaaa
     2881 caacgcaagg aagaaagagc ttctctcggc ttagtcacag gttctgaaat taggaaaagg
     2941 aacccagaag acttcaagcc taaggggaaa ctatgggctg acgatgacag aagtgtggac
     3001 tacaatgaaa aactcagctt tgaggcccca ccaagcatct ggtcaaggat agtcaacttt
     3061 ggctcaggtt ggggcttctg ggtctccccc agcctgttca taacatcaac ccacgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt gcacaagtca
     3181 ggcgaattct gtcgcttgag gttcccaaag ccaatcagga ctgatgtgac tggcatgatc
     3241 ttggaagaag gtgcgcccga aggcaccgtg gccacactac tcatcaaaag gtctactgga
     3301 gaactcatgc ccctagcagc tagaatgggg acccatgcaa ccatgaagat tcaagggcgc
     3361 actgttgggg gtcagatggg catgctcctg acaggatcca acgccaaaag catggatcta
     3421 ggcaccacac caggtgattg cggctgtccc tacatctaca agagaggaaa tgattatgtg
     3481 gtcattggag tccacacggc tgctgctcgt gggggaaaca ctgtcatatg tgccacccag
     3541 gggggtgaag gggaagctac acttgaaggt ggtgatagta agggaacata ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca aaaccaaatt ctggagatca
     3661 tccacagcac cactcccacc tggcacctat gaaccagcct acctaggtgg caaggacccc
     3721 agggtcaaaa atggcccctc gttgcagcaa gtcatgaggg accagctgaa accatttaca
     3781 gagcctaggg gtaagccacc aaagccaagc gtgttagaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaagtggt cgttcgcaca agcttgcgcg
     3901 tcccttgaca aaaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggaat ccttcacagg caagctggca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agaacatgac cccagtctac acaggtgcac ttaaggatga attagtcaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttagcaacc
     4141 atgatccggt gtgctcgagc attcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acacttcctg tcagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagaag
     4261 cactccaggt acagatacca ctatgatgct gattactctc ggtgggattc aacacaacag
     4321 agagccgtgc tggcagctgc tctagaaatc atggttaaat tctcctcaga accacatttg
     4381 gctcaggtag tagcagaaga tcttctttct cctagcgtgg tggatgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcactct ctgtgcactc tccgaagtta caaatttgtc cccagacatc
     4561 atacaggcta attctctctt ctccttctat ggtgatgatg aaattgttag tacagatata
     4621 aaactagacc cagagaagtt gacagcaaag cttaaggaat acgggttgaa accaacccgc
     4681 cctgataaaa ctgaaggacc tcttgttatt tctgaagact tagatggttt gactttcctg
     4741 cggagaactg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatgaag atccatctga atcaatgatt
     4861 ccacactctc aaagacccat acaattgatg tccttactgg gagaggccgc actccacggc
     4921 ccaactttct atagtaaaat cagcaaatta gtcattgcag agctaaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agctttgtga atgaagatgg cgtcgaatga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgtcg gtgccgctat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtgtc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atctgaatcc
     5341 ctacctatct catttggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gatcctcgcg gggaacgcgt tcaccgccgg aaaaattata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttga gtcccagcca ggtcactatg ttcccccaca taatagtgga
     5521 tgttaggcaa ttggaacctg tgttgatccc cctacctgat gttaggaata acttctatca
     5581 ctataatcag tcaaatgatt ctactattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtctttac agtctcttgt cgagttctca cgaggccatc
     5701 ccctgatttt gattttatat ttttggtgcc acctacagtt gagtcaagaa ctaaaccatt
     5761 tactgtccca atcttaactg ttgaagaaat gaccaattca agattcccca ttcctttgga
     5821 aaaattgttc acgggtccca gcagtgcctt tgttgttcaa ccacaaaatg gcagatgcac
     5881 gactgatggc gtgctcttgg gcaccaccca actgtctcct gtcaacatct gcactttcag
     5941 aggggatgtc acccacattg caggttctcg tgattacaca atgaatttgg cctctctaaa
     6001 ttggaacaat tatgacccaa cagaagaaat tccagcccct ctaggaactc cagattttgt
     6061 gggaaagatc caaggtgtgc tcactcaaac cacaaaggga gatggctcga cccgtggcca
     6121 taaagctaca gtttacactg ggagtgcccc ctttactcca aagctgggca gtgtccaatt
     6181 cagtactgat acagagaatg actttgaaac tcaccaaaac acaaagttca ccccagtcgg
     6241 tgttatccag gatggtggca ccacccatcg aaatgaaccc caacaatggg tgctcccaag
     6301 ttattcaggt agaaatgtcc ctaatgtaca cctagcccct gctgtagccc ccacttttcc
     6361 gggtgaacaa cttcttttct ttaggtccac tatgcccgga tgcagcgggt atcccaacat
     6421 ggatttggac tgcctactcc cccaggagtg ggtgcagcac ttctaccaag aagcagctcc
     6481 ggcacaatct gaagtggctc tattgagatt tgtgaatcca gacacgggta gggtcctgtt
     6541 tgagtgcaaa cttcataaat caggctatgt cacagtggct cacaccggcc agcatgattt
     6601 ggtcatcccc cccaatggtt attttaggtt tgattcctgg gttaatcaat tttacacact
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcttta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttagctct ggacttggtt ccctaatcaa cgctggggct
     6781 ggggctatca accaaaagat tgattttgaa aataacagaa aattgcagca agcttccttc
     6841 cagtttagta gtaatctaca acaggcttcc tttcaacatg acaaagagat gctccaagca
     6901 caaattgagg ccactaaaaa gttgcaacag gaagtgatga aagtcaagca ggcaatgctc
     6961 ttagaaggtg gattctctga aacagatgca gcccgtggag caatcaacgc ccctatgaca
     7021 aaggctttgg actggagcgg aacaaggtac tgggcccctg atgctaggac tacaacatac
     7081 aatgcaggcc gtttctccac ccctcaacct tcgggggcac tgccaggaag aatcaatccc
     7141 aggactccta cccccgctcg gggctccccc agcacatctt ctaatgcttc tactgctgct
     7201 tctatatatt caaatcaaac tgtttcaacg agacttggtt ctacagctgg ttctggcacc
     7261 aatgtctcga gtctcccgtc aactgcaagg actaggagtt gggttgagga tcaaaacaga
     7321 aatttgtcac ctttcatgag aggggctcac aacatatcat ttgtcacccc accatctagc
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca ttcgtaggcg aggggagtca
     7501 cgggtgtga
//