Typing tool

Complete norovirus genomes

AB365435  GII.3
 GII.P21

Length: 7,627 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7495
LOCUS       AB365435                7627 bp    RNA     linear   VRL 25-APR-2008
DEFINITION  Norovirus Hu/Texas/TCH04-577/2004/US genomic RNA, complete genome.
ACCESSION   AB365435
VERSION     AB365435.1
KEYWORDS    .
SOURCE      Norovirus Hu/Texas/TCH04-577/2004/US
  ORGANISM  Norovirus Hu/Texas/TCH04-577/2004/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Estes,M.K. and Atmar,R.L.
  TITLE     New Classification System of the Noroviruses and Sapoviruses
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7627)
  AUTHORS   Katayama,K., Estes,M.K. and Atmar,R.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2007) Contact:Kazuhiko Katayama National
            Institute of Infectious Diseases, Virology II; Gakuen 4-7-1,
            Musashi-murayama 2080011, Japan
FEATURES             Location/Qualifiers
     source          1..7627
                     /organism="Norovirus Hu/Texas/TCH04-577/2004/US"
                     /mol_type="genomic RNA"
                     /strain="Hu/Texas/TCH04-577/2004/US"
                     /isolation_source="Human stool"
                     /db_xref="taxon:479952"
                     /country="USA:Texas, Houston"
                     /note="genogroup II"
     CDS             5..5104
                     /note="Nonstructure proteins, N-terminal, NTPase, 3A-like
                     protein, VPg, Protease, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAG30938.1"
                     /translation="MKMASNDASAAAAANSNNDNAKSSSDGVLSNMAVTFKRALGARP
                     KQPPPRDKPPRPPRPPTPELVKTIPPPPPNGEDEPTISYNVKEGVSGLPELSTVTQPE
                     ESSTAFSVPPLSQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLYWRPVYTPQYLISPDTLRKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKVKKVANVILCALSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKDETNELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLSRIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIASSLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKDTFKPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTASSLVARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLVDTMRVGSQLKNVKTM
                     TELKQALKNISVKKCQLVYGGGTYTLESDGKGSVHVEKVKNTSVQTNNELSGALHHLR
                     CARIRYYVKCVQEALYSILQIAGAAFITTRIAKRMNIQNLWSKPQVEDLEETSNEEGC
                     PKPKNDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGTQEFFGVPTKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAMLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQRWTYAQACASLDKTTSSGHPHHMRKNECW
                     NGETFTGKLADQASRANLMYEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     STMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTTKLR
                     EYGLKPTRPDKTEGPLIISEDLDGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6731
                     /codon_start=1
                     /product="VP1"
                     /protein_id="BAG30939.1"
                     /translation="MKMASNDATPSNDGAAGLVPEINNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSARQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFMGVLTRSTSRASDQADTATPRLFNYYWHIQLDNPNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTAGRFTPKLGSLEISTESDDFHQNQP
                     TRFTPVGIGVDNEADFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPSQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     CDS             6731..7495
                     /codon_start=1
                     /product="VP2"
                     /protein_id="BAG30940.1"
                     /translation="MAGAFIAGLAGDILTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPNATSTTSMSGGFTNQAVHRTTPNFKTNQASKTTPSSGSSVRSNSTQVTSLSS
                     YSSGSSRSSGSTVVSSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESKV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgccaaca gcaacaacga
       61 caacgcaaaa tcttcaagtg acggggtatt atctaatatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac aaccgccccc gagggacaag ccaccaagac ccccaaggcc
      181 acccacacca gagttggtta agacaatccc ccctccccca cccaacgggg aggacgagcc
      241 aaccatttct tacaacgtca aagagggtgt ctctggtttg cctgaactct caacggtcac
      301 ccaaccggaa gagagctcta cggcattcag cgttccccct cttagtcaga gggagaacag
      361 agatgcaaag gaacccttga ctggaaccat cctggagatg tgggacgggg agatctacca
      421 ttatggcttg tacgtggaac gaggactggt gctcggtgta cacaaaccac cagcagccat
      481 cagccttgct aaggttgagc tgaccccttt gtctttgtat tggagaccag tgtacacccc
      541 acagtacctc atttcccctg acactctcag aaagttgcat ggggagacgt tcccttacac
      601 agcctttgac aacaactgct atgccttctg ctgttgggtt cttgacttga acgattcatg
      661 gctgagcaga aggatgatac agaggacaac aggcttcttt cgaccctacc aggactggaa
      721 caggaaaccc ctccccacga tggatgactc caaagtgaag aaggtggcca atgttatcct
      781 ctgtgctctc tcatcattgt ttactagacc aattaaggac attattggga agttgaaacc
      841 cctaaacatc ctcaacatcc tagccacatg tgattggact tttgcaggca tagtagaatc
      901 cctgatcctc ttggctgaac tgtttggagt tttctggaca cccccagatg tgtctgcaat
      961 gatcgctccc ttactgggtg attatgagct acaggggccc gaggacctcg ctgtggaact
     1021 cgtacccgta gtgatgggag ggataggttt ggtgctggga ttcaccaaag agaaaatcgg
     1081 caaaatgctt tcatctgctg cttcaaccct gagggcatgt aaagatcttg gtgcatatgg
     1141 gctggaaatc ctcaagttgg tcatgaaatg gtttttccca aagaaagacg agacaaacga
     1201 attggctatg gtgagatcca tcgaggatgc agtgctagac ctcgaggcca ttgagaacaa
     1261 ccatatgaca gctctactca aggataagga cagccttgca acctacatga ggactcttga
     1321 cttggaggag gagaaggcga ggaagctgtc caccaagtct gcctcaccgg acattgtggg
     1381 cacgatcaac gccctactgt caaggattgc agctgcccgg tctctagtac acagggctaa
     1441 ggaggaactg tcaagtaggc cccgaccggt cgttgtgatg atttcaggga gaccaggtat
     1501 agggaaaacc catctagcta gagagttggc aaagaagatc gcctcctcac tcacaggtga
     1561 ccagagggtg ggcctcatcc cacgcaacgg agttgaccac tgggatgcat acaaaggtga
     1621 aagagtcgtt ctctgggacg actacgggat gagcaaccct atccacgacg cccttcgact
     1681 ccaggagctt gctgacacct gtcccctcac acttaactgt gacaggattg agaacaaagg
     1741 caaagtcttt gacagtgacg ccataataat aactaccaat ttagccaacc cagcgccact
     1801 ggactatgtc aactttgaag cttgctcaag acgtatagat ttcctcgtct atgctgatgc
     1861 ccctgaagtt gagaaggcta aacgggactt cccaggccag ccagatatgt ggaaagacac
     1921 cttcaaacct gacttctcac acataaaact gacattagcc ccacaaggag gttttgataa
     1981 gaatggcaac acccctcatg ggaagggtgt tatgaagacc ctcactgcta gttctctcgt
     2041 tgcccgagca tcagggctcc tccacgagag actagacgag tatgagctgc aaggcccaac
     2101 tcccacaaca ttcaacttcg accgtaacaa ggtgcttgct tttaggcaac ttgctgctga
     2161 gaacaagtac ggtcttgttg acacaatgag ggtcggatca cagctcaaga atgtcaaaac
     2221 catgacagaa ctcaaacagg ctctcaagaa catctcagtc aagaaatgcc agcttgtgta
     2281 tggcgggggc acgtacacac ttgaatctga tggcaaaggc agtgtgcatg tcgagaaggt
     2341 gaagaacacc agtgtgcaaa ctaacaacga gctctccggg gctttgcacc atctcaggtg
     2401 tgccaggatc aggtattatg tcaagtgtgt ccaggaagct ctctactcca tcttgcaaat
     2461 tgccggggct gcattcatta ccacgcgcat tgcaaagcgc atgaatatac aaaacctctg
     2521 gtccaaacca caagtggaag atttggagga gactagcaac gaggagggtt gtccaaaacc
     2581 taaaaatgat gaggaatttg ttatctcctc tgatgacatc aaaaccgagg gcaagaaagg
     2641 aaagaacaaa actggccgtg gcaagaagca cacagccttt tccagcaaag gcctcagtga
     2701 tgaggagtac gatgagtata agagaatcag ggaagagagg aatggcaagt actccataga
     2761 ggaataccta caggacagag acagatacta tgaggaggtg gccatagcca gagcaactga
     2821 ggaagatttc tgtgaagaag aggaggctaa aatccggcaa aggattttca gaccaacaag
     2881 gaaacaacgt aaagaggaaa gggcctctct cggtttggtc acaggttctg agatcagaaa
     2941 gagaaaccca gatgacttca agcccaaagg gaaactatgg gccgacgatg acaggagtgt
     3001 tgactataac gagaaactta gtttcgaggc tccaccaagc atttggtcac gaatagtcaa
     3061 ctttggttca gggtggggtt tttgggtctc gcctagcctc ttcataacat caacccatgt
     3121 cattccccag ggcacacagg agttctttgg agtgcccacc aaacagatac aaattcacaa
     3181 atcaggtgag ttctgccggc ttaggttccc aaaaccaatc aggacagatg tcacgggcat
     3241 gatcttggag gaaggcgctc cagaaggcac tgttgccaca cttctcatca agagaccaac
     3301 tggggaactc atgcccttgg cagccagaat gggcacccac gcgaccatga aaattcaggg
     3361 tcgcactgtt ggtggacaga tgggcatgct actcacaggg tctaacgcta agagcatgga
     3421 tttgggcaca actcctggcg attgtggttg tccctatatc tacaagagag ggaacgacta
     3481 cgtggtcatt ggagttcata ccgccgccgc tcgtggagga aacaccgtca tctgtgcaac
     3541 ccagggaagc gagggtgagg ccatgctaga aggtggtgac aacaaaggaa cttactgtgg
     3601 agcaccaata ttaggccctg gaaatgcccc caaactcagc accaaaacca aattctggag
     3661 gtcttccacc acccccctgc cacccggaac ctatgaacca gcttatctgg gtggcaagga
     3721 ccctagagtg aaaggtggtc cctcactgca acaggttatg agggatcaac taaaaccatt
     3781 cactgagccc agaggcaaac cacccaaacc aagtgtgcta gaagctgcca agaagactat
     3841 aatcaatgtg cttgaacaga caatagaccc accccaaaga tggacatacg cacaggcgtg
     3901 tgcatcacta gacaagacca cttccagcgg ccaccctcac cacatgcgga agaacgagtg
     3961 ctggaatggg gagactttca cgggaaaact ggcagaccaa gcatcaaggg ctaacctaat
     4021 gtatgaggaa ggaaagaaca tgaccccagt gtacacagga gctttgaagg atgagctagt
     4081 caagactgat aagatctatg ggaagatcaa aaagagactc ctgtgggggt cagacttgtc
     4141 aaccatgata cggtgtgcac gagccttcgg tggactaatg gacgagctca aggcccattg
     4201 cgttacacta ccagtcaggg ttggcatgaa catgaatgag gatggaccca taatatttga
     4261 gaaacattcc agatacaggt atcattatga tgcagattac tcccgctggg attcaacaca
     4321 acaaagagca gtgctggctg cagctctgga aataatggtc aaattctcat cagaacctca
     4381 tctggcccaa gtagttgcag aagacctctt gtcccccagt gtgatggacg tgggtgattt
     4441 caagatatca atcaacgagg ggttgccctc tggtgtacct tgcacctcac aatggaactc
     4501 cattgcccac tggctcctga cactatgtgc gctgtctgaa gtcactgacc tgtcccctga
     4561 catcatccag gcaaactccc tattctcctt ttatggtgat gatgaaatag taagcacaga
     4621 catcaaattg gacccagaga aattgacaac aaaattgagg gaatatgggc taaaaccaac
     4681 ccgtcctgat aaaacagaag gacccttaat tatctctgaa gatttggatg gcctgacctt
     4741 cttacggaga acggtgaccc gtgatccggc tgggtggttt ggcaaactgg accaaagttc
     4801 aatactcagg cagatgtact ggaccagggg accaaaccat gaggacccct ttgaaacaat
     4861 gataccacac tcccaaagac ccatacaact gatgtcatta ctgggtgaag ctgcattgca
     4921 tggcccatca ttctacagta aaattagcaa attggtcatc tcagaattga aagagggtgg
     4981 aatggatttt tacgtgccca gacaagaacc aatgtttagg tggatgagat tctcagattt
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccac tccatctaat gatggtgccg ccggcctcgt cccagagatc aacaatgagg
     5161 caatggcgct agatccagtg gcgggtgcag cgatagcagc acccctcact ggccagcaaa
     5221 atataattga tccctggatt atgaataatt ttgtgcaagc acctggtggt gagtttacag
     5281 tatcccctag gaattcccct ggtgaagtgc ttcttaattt ggaattgggc ccagaaataa
     5341 atccctattt ggcacatctc gctagaatgt ataatggtta tgcaggtgga tttgaagtgc
     5401 aggtagtcct agctggaaat gcgtttacag caggaaagat aatctttgca gctatacccc
     5461 ctaatttccc aattgataat ctaagcgcac gacagattac aatgtgccca catgtgattg
     5521 tggatgtcag acagttggaa ccagtcaacc tcccgatgcc tgacgttcgc aacaatttct
     5581 ttcattataa ccaaggatct gattcgagat tgcgcttaat tgcaatgctg tacacacctc
     5641 ttagggcaaa taattctggg gatgatgttt ttactgtgtc ttgtagagtg ctgactaggc
     5701 ctagccctga cttctcattc aatttccttg tgccacccac tgtggagtca aagacaaaac
     5761 ccttcaccct ccctattctg actatctctg aaatgtccaa ttctaggttt ccagtgccga
     5821 ttgactctct gcacaccagc ccaactgaga atattgttgt ccagtgccaa aatgggcgcg
     5881 tcactcttga tggtgagctg atgggcacca cccaactctt acctagtcaa atctgtgctt
     5941 tcatgggcgt gctcaccagg tcaacaagca gggccagtga tcaggccgac acagcaaccc
     6001 ctaggttgtt taattattat tggcatatac aattggataa tccaaatggg actccttatg
     6061 atcctgcaga agacatacca ggccccctag ggacaccaga tttccggggc aaagtctttg
     6121 gcgtggccag ccagagaaac cccgacagca caactagagc acatgaagca aaggtggaca
     6181 caacagctgg tcgtttcacc ccaaaactag gctcattaga gatatccact gaatctgatg
     6241 actttcatca aaaccaacca acaagattca ccccagttgg cattggggtt gacaatgaag
     6301 cagactttca acagtggtct ttacccgact attctggtca gttcacccac aacatgaact
     6361 tagccccagc tgttgctccc aacttccctg gagagcagct ccttttcttc cgctcacagt
     6421 taccatcctc tggtgggcga tccaacggga ttctagactg cctggtccct caagagtggg
     6481 ttcagcactt ctaccaagaa tcggccccct ctcaaactca agtggccctg gttaggtatg
     6541 tcaaccctga cactggcaga gtattatttg aggccaagct gcacaaatta ggtttcatga
     6601 ctatagctaa gaatggtgac tctccaataa ctgtccctcc aaatggatac tttaggtttg
     6661 aatcttgggt gaacccattt tacacacttg cccccatggg aactgggaat gggcgtagaa
     6721 ggattcaata atggctggag cttttatagc aggattagct ggtgatatac tcacaaatac
     6781 tgtaggatct ttagttaatg caggggctaa tgccattaat caaaaagttg attttgaaaa
     6841 taataaatat ttacaaaatg cttcctttaa tcatgataag gaaatgttaa atgcacaaat
     6901 tgaggcaaca aagaggttac aggctgacat gattgctatc aaacaagggg ttttgaccgc
     6961 tggcggcttc tcccccactg atgcagcccg cggggcaatt aacgccccca tgacaaaagt
     7021 cctagattgg aatgggacga ggtactgggc accaaatgcc acctccacaa cctcgatgtc
     7081 gggtggcttc acaaatcagg ctgtgcacag aaccacgcca aattttaaaa cgaaccaggc
     7141 ttccaaaacc acacccagca gtgggtcttc agtgaggtca aattcaaccc aagtcactag
     7201 cctgagctca tactcgtccg ggtcgtctcg atccagcggg tctacagttg ttagctcatt
     7261 accatcctct aacaggacta gggactgggt caaccaacaa aattttaatt tggaaccaca
     7321 catgcctggg tctcttagga cagcttttgt cactccacca tctagtacag cctctagttc
     7381 aggcacggtc tcaaccgtgc ccaaaaatgt tttggactcc tggacatctg cgttcaatac
     7441 gcgcagacag ccgctattcg cacaccttcg aagaaggggg gagtcaaaag tttagtgaaa
     7501 agattatttt aaatttgatt taaattggat ttgatttgga atcttttaaa aaaaaaaaaa
     7561 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     7621 aaaaaaa
//