Typing tool

Complete norovirus genomes

AB220921  GII.4 Asia
 GII.P12

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       AB220921                7559 bp    RNA     linear   VRL 22-JUL-2006
DEFINITION  Norovirus Hu/Chiba/04-1050/2005/JP genomic RNA, complete genome.
ACCESSION   AB220921
VERSION     AB220921.1
KEYWORDS    .
SOURCE      Norovirus Hu/Chiba/04-1050/2005/JP
  ORGANISM  Norovirus Hu/Chiba/04-1050/2005/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Okada,M., Tanaka,T., Oseto,M., Takeda,N. and Shinozaki,K.
  TITLE     Genetic analysis of noroviruses associated with fatalities in
            healthcare facilities
  JOURNAL   Arch. Virol. 151 (8), 1635-1641 (2006)
   PUBMED   16521046
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Okada,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2005) Mineyuki Okada, Chiba Prefectural Institute
            of Public Health, Division of Virology; 666-2, Nitona-Cho,
            Chiba-Shi, Chuo-Ku, Chiba 260-8715, Japan
            (E-mail:m.okd4@mc.pref.chiba.jp, Tel:81-43-266-6723,
            Fax:81-43-265-5544)
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/Chiba/04-1050/2005/JP"
                     /mol_type="genomic RNA"
                     /strain="Hu/Chiba/04-1050/2005/JP"
                     /isolation_source="stool"
                     /db_xref="taxon:336619"
                     /country="Japan"
     CDS             5..5104
                     /codon_start=1
                     /product="non structural polyprotein"
                     /protein_id="BAE98190.1"
                     /translation="MKMASNDASAAAAANSNNDTAKSSSDGVLSSMAVTFKRALGARH
                     KQPPPRDIPQRPPRPPTPELAKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELGDTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPPGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     PELKQALKNVAIKNCQIVYGGCTYRLESDGKGDVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETASKDGC
                     PKPKDDDEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKITINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6707
                     /gene="VP1"
     CDS             5085..6707
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="BAE98191.1"
                     /translation="MKMASNDASPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRTNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVIHIPGTRTYRMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTKGDGSTRGHKATVSTGSVDFTPKLGSVQFATDTDNDFETGQNTRFTPVGVIQDG
                     SSAHRNEPQQWVLPDYSGRTVHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPSQSDVALLRFVNPDTGRVLFECKLHKAGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     gene            6707..7513
                     /gene="VP2"
     CDS             6707..7513
                     /gene="VP2"
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="BAE98192.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFEFSSNLQQASFQHDKEMLQAQIEATKKLQQGMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRTNPRATVPARGSPSTPS
                     NTSTVTSVYSDQTISTRLGSTAGSGTRVSSLPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcataaac agcctccccc gagggacata ccacaaagac ctccacgacc
      181 acccaccccg gaacttgcca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtttct tacagcgcca aagatggcgt ttccggtttg cctgagctta ccactgtctg
      301 gcagccggat gaaaccaaca cggcgttcag tgttccccca ctcaaccaga gggagaatag
      361 ggacgccaag gagccgctaa ccggaacaat cctggaaatg tgggacgggg agatctatca
      421 ttacggtctg tatgtggaac gaggccttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggttgagc tagcaccact ctctctgttt tggagaccag tgtatacacc
      541 acagtatctc atctccccag acactctcag gagactgcat ggagagtcgt tcccctacac
      601 agcctttgac aacaactgct atgccttctg ttgttgggtc ctggatctaa acgactcgtg
      661 gttgtgcagg agaatgatcc agaggacaac tggtttcttc agaccttacc aagactggaa
      721 caggaaaccc ctccccacca tggatgactc caaattgaag aaggtagcca acatattctt
      781 gtgtgcgcta tcttcgctat tcactaggcc catcaaagac ataataggaa aggtgagacc
      841 gcttaacatc cttaacatct tggcctcgtg tgattggact tttgcaggca tagtggaatc
      901 tttgatcctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactaggtg actacgaact gcaggggccc gaggaccttg cagtggaact
     1021 cgttccagta gtgatggggg ggattggttt ggtgctagga ttcactaaag agaagatcgg
     1081 aaaaatgttg tcatctgctg catccacctt aagggcttgt aaagaccttg gtgcatacgg
     1141 attggaaatc ctaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gttggctatg gtgaggtcca tcgaggatgc ggtgctggac ctcgaagcaa ttgagaacaa
     1261 tcacatgact gccctcctca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 cctcgaggag gagaaggcca ggaagctttc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gctctcctgg cgagaatcgc cgctgcacgt tccctggtgc atcgggcgaa
     1441 agaggaactc tccagcagac caagacctgt tgttgttatg atatcaggca ggccagggat
     1501 agggaaaact caccttgcta gggaactggc caagaaaatc gcagcttcgc ttacagggga
     1561 ccagcgtgtg ggtctcatcc ctcgcaatgg cgttgatcac tgggatgcat ataaggggga
     1621 aagagtcgtc ctgtgggacg attatggaat gagtaatccc atccacgacg ccctcaggtt
     1681 acaggaactt ggtgacacct gccccctcac gctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaac ctggccaacc cagcaccatt
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt acgcagaagc
     1861 ccctgaggtc gagaaggcaa agcgtgattt cccaggtcaa cctgacatgt ggaagaatgc
     1921 attcagttct gacttctcgc acataaaact gacgctggct ccgcaaggtg gcttcgacaa
     1981 gaacggaaac accccacccg ggaaaggcgt catgaaaacc ctcaccactg gttccctcat
     2041 cgcccgagca tcagggctac tccatgagag gttagatgag tatgagctgc agggcccaac
     2101 ccccaccacc tttaactttg accgcaacaa ggtgcttgcg ttcagacagc ttgctgccga
     2161 aaacaagtac gggttgttgg acacaatgag agttggaaaa cagctcaagg atgtcaagac
     2221 catgccagag ctcaaacaag cgctcaaaaa tgtcgcaatc aagaattgtc agatagtgta
     2281 tggtggctgc acttacaggc ttgagtctga tggcaagggt gatgtgaagg ttgacagagt
     2341 tcagaacgcc actgtacaga ccaacaatga gcttgccggc gccctacatc atcttaggtg
     2401 tgccagaatc agatattatg tcaagtgtgt ccaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtaa ccacgcgcat tgtcaagcgc atgaacatac aagacctctg
     2521 gtccaagcca caggtggagg acacagagga gaccgctagc aaagatgggt gcccaaaacc
     2581 caaggatgat gacgagttcg ttgtctcatc cgatgacatc aaaaccgagg gcaagaaagg
     2641 gaagaacaag tctggccgtg gtaagaagca cacagcattc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca aaagaatcag agaagaaagg aacggcaaat actccataga
     2761 agaatacctt caggacagag ataagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaagaag aagaggccaa gatccgacaa aggattttca ggccaacaag
     2881 gaaacaacgc aaagaggaga gggcctctct cggtttggtc acaggctctg aaatcaggaa
     2941 gaggaaccca gacgacttca agcctaaagg aaagctgtgg gctgatgatg acaggagtgt
     3001 tgactacaat gagagactca attttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ttttggttcg ggttggggct tttgggtttc ccccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agttctttgg tgttcccatc aaacaaattc agatacacaa
     3181 atcgggagaa ttctgtcgtt tgaggtttcc aaaaccaatc agaactgacg tgacaggcat
     3241 gatcttagaa gaaggtgcac ccgaagggac cgtggtcaca ctactcatta agaggccaac
     3301 tggagaactc atgcccttgg cagccagaat gggaacccat gcaaccatga agattcaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct cctaacagga tccaacgcca agagtatgga
     3421 cctgggcacc acaccaggtg actgtggctg tccctacatt tacaagaggg ggaatgacta
     3481 tgtagtcatt ggagtccaca cagctgccgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaagggagc gagggagaag ccacacttga gggcggtgac agcaagggga cctactgcgg
     3601 tgcaccaatc ttaggtccag gaagtgcccc aaagctcagc accaagacta aattctggag
     3661 atcatccacg gcaccactcc cacctggtac ctatgagcca gcctacctcg gcggcaagga
     3721 ccccagagtt aagggtggcc cttcattgca acaagttatg agggaccagc tgaaaccatt
     3781 cactgaaccc aggggtaaac caccaaaacc aagtgtgtta gaagctgcca agaaaaccat
     3841 cgtcaatgtc cttgaacaaa caattgatcc acctcaaaaa tggtcatttg cgcaggcatg
     3901 cgcatccctt gacaagacca cttccagtgg tcacccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttta caggcaaatt ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaggag ggaaagaaca tgaccccagt ttacacgggt gcgcttaagg acgagctagt
     4081 caagactgat aaaatttatg gcaagatcaa aaagaggctt ctctggggtt cggacctggc
     4141 gaccatgatc cggtgcgctc gagcattcgg gggcctgatg gaggaactca aagcacattg
     4201 tgtcacacta cctgtcagag tgggtatgaa tatgaatgag gatggtccta tcatctttga
     4261 gagacactcc agatataaat atcattatga tgctgattac tcccggtggg actcaacaca
     4321 acaaagagcc gtgttagcag cggctttaga aatcatggtc aagttctccc cagagccgca
     4381 tctggcccaa aaggttgcag aagaccttct ttctcccagc gtgatggacg tgggtgattt
     4441 caaaataaca atcaatgagg gtctcccctc cggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctatgtgc actctctgag gttacaaacc tgtcccctga
     4561 cattatccag gccaattctc tcttttcttt ctacggtgat gatgaaattg tgagcacaga
     4621 cataaaattg gacccagaaa agctgacagc caaactcaag gaatacgggt tgaaaccgac
     4681 ccgccctgac aagactgagg gaccccttgt tatctctgaa gacctgaatg gcctaacctt
     4741 cctgcggagg accgtgaccc gcgacccagc aggctggttt ggaaagttgg aacagagttc
     4801 aatactcaga caaatgtatt ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccagaggc ccatacaatt gatgtctttg ctgggtgagg ctgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa actggtcatc gcagagttga aggaaggtgg
     4981 catggatttt tacgtgccaa gacaagagcc aatgttcaga tggatgagat tctcggatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccag cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt aggactaatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatctga
     5341 atccatacct ttctcacctg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccgggaaaat catctttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc tgatgttagg aataatttct
     5581 accattacaa tcaatcaaac gactccacca ttaaattgat agcaatgctg tacacaccac
     5641 ttagggctaa taatgctggg gatgatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccccga ttttgatttt atatttctgg tgccacccac agttgagtca agaaccaaac
     5761 cattcaccgt cccaatttta actgttgagg aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaaatt gttcacgggt cccagcagtg cctttgtcgt ccaaccacaa aatggcaggt
     5881 gcacgactga tggcgtgctc ttaggcacta cccagctgtc ccccgtcaac atctgcacct
     5941 tcagaggcga tgtcatccac attccaggta ctcgtactta cagaatgaat ttggcttctc
     6001 aaaattggaa caattatgac ccaacagaag aaatcccagc ccctctggga accccagatt
     6061 tcgtgggaaa gatccaaggc atgctcaccc aaaccacaaa gggagacggc tcgacccgcg
     6121 gtcacaaagc tacagtgagc actgggagtg ttgactttac tccaaagctg ggcagcgttc
     6181 agttcgccac tgatacagac aatgattttg aaactggcca aaacacaagg ttcaccccag
     6241 tcggtgtcat ccaggatggt agtagtgccc acagaaatga accccaacaa tgggtactcc
     6301 cagattactc aggtagaact gttcacaatg tacacctagc ccctgccgta gcccccactt
     6361 ttccaggtga gcaacttctt ttcttcagat ctactatgcc cggatgcagt gggtatccca
     6421 atatggattt ggattgtcta ctcccccagg aatgggtgca gcacttctac caagaggcag
     6481 ccccatcaca atctgatgtg gctttgctga gatttgtgaa tccagacaca ggtagggttc
     6541 tgtttgagtg caagcttcat aaagcaggct atgtcacagt ggctcacact ggccagcatg
     6601 atttggttat cccccccaat ggctacttta gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggagcggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctga tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttcgaattt agcagcaatc tacaacaagc ttcctttcaa catgacaaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttaca gcagggtatg atgaaagtca aacaggcaat
     6961 gctcctagag ggtggattct ctgaaacaga tgcggcccgt ggggcaatca acgccccaat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggct cctgatgcta gaactacaac
     7081 atacaatgca ggccgttttt ccacccctca accttcgggg gcactgccag gaagaactaa
     7141 tcccagggct actgtccccg ctcggggctc ccccagcaca ccttctaaca cctctactgt
     7201 tacttctgtc tattcagatc aaactatttc aacgagactt ggttctacag ctggttctgg
     7261 caccagagtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaag
     7321 caggaatttg tcacctttca tgaggggggc tcacaacata tcgttcgtca ccccaccatc
     7381 tagtagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttc cttttcttta gtgtctttt
//