Typing tool

Complete norovirus genomes

AB187514  GI.3
 GI.P14

Length: 7,746 | 3 CDS

ORF1: 5..5404
ORF2: 5388..7019
ORF3: 7019..7666
LOCUS       AB187514                7746 bp    RNA     linear   VRL 01-SEP-2005
DEFINITION  Norovirus Hu/GI/Otofuke/1979/JP genomic RNA, complete genome.
ACCESSION   AB187514
VERSION     AB187514.1
KEYWORDS    .
SOURCE      Norovirus Hu/GI/Otofuke/1979/JP
  ORGANISM  Norovirus Hu/GI/Otofuke/1979/JP
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Wakuda,M., Sasaki,J. and Taniguchi,K.
  TITLE     Complete nucleotide sequence of genome of Otofuke virus, a member
            of Caliciviridae, associated with acute non-bacterial
            gastroenteritis
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7746)
  AUTHORS   Taniguchi,K. and Wakuda,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-AUG-2004) Koki Taniguchi, Fujita Health University
            School of Medicine, Department of Virology and Parasitology;
            Kutsukake, Dengakuga-Kubo 1-98, Toyoake, Aichi 470-1192, Japan
            (E-mail:kokitani@fujita-hu.ac.jp, Tel:81-562-93-2467,
            Fax:81-562-93-4008)
FEATURES             Location/Qualifiers
     source          1..7746
                     /organism="Norovirus Hu/GI/Otofuke/1979/JP"
                     /mol_type="genomic RNA"
                     /strain="Otofuke"
                     /db_xref="taxon:290280"
                     /country="Japan"
     CDS             5..5404
                     /function="nonstructural"
                     /note="A polyprotein is cleaved to helicase, VPg,
                     protease, and RNA-dependent RNA plolymerase;
                     ORF1"
                     /codon_start=1
                     /product="nonstructural protein"
                     /protein_id="BAE43832.1"
                     /translation="MMMASKDAIAVADVSNNNANTNNENIGSRLMARLRGRIGPQRGE
                     NTTKIKDANMALDLLRRSQTPSPSRQDHPPKDQRDRPPRTAMEVRKTMGWDEEPRQQE
                     STVKAWCDLAREEKEEIMRNNEKLFDAGGVAPAILPSTFERATPHESTDECQAVTWSA
                     SDGVDIGVDSLKTVRGPPWNMCPLPPLEARNSGPAREPLIGDMVEFYEGHIFHYAIYI
                     GQGKTIGVHSPQAAFSIPRITIHPLVAWWRVCYTPTDQQRLTYDQLRELENEPWPYAS
                     ITNNCYEFCCKVMALDDTWLQRKLVTTGKFNHPTQEWSKDTPDFHQDSKLEMVRDAVL
                     SAINGLVSQPFKNILSKIKPLNLINLLSNCDWTFMGVVELIVLVAELFDVFWTPPDIS
                     SFIASLLPDFHLQGPEDLAKDLVPLILGGIGLAIGFTRDKVTKVMKSAVDGLRSATQL
                     GQYGLEIFSIIKKYFFGGDQTERTLRGIEDAVIDMEVLSSTNVTQLVRDKKSAKAYMN
                     ILDIEEEKARKLSVRSADPHIVTSVNNLISRISMARSALAKAQAEMTSRIRPVVIMMC
                     GPPGIGKTKAAEHLASRLATEIRPGGKVGLVPRESIDHWDGYHGEEVLLWDDYGMSKI
                     TEDCNKLQAIADTAPLSLNCDRIENKGMQFVSDAIIITTNAPGPAPVDFVNLGPVCRR
                     VDFLVYCSAPEIEQARRAHPGDTNAIKDLYKKDFSHLKMDLAPQGGFDNQGNTPFGKG
                     VMKPTTLNRLLIQATALTMERQDEFQLQGMVYNFDEDRVAAFTSLARANGLGLINMAT
                     LGKKLRNVKTMEGLRNALVGYRIEECDIIWNTRAYSIKSDGKSVTIKEKQNQTSSQHQ
                     AVSTATLALSRLRAARAIAYASCLQSAVLSILQVAGSAVVVSRAVKRMFGTSTEQPAL
                     EGGHKEHNCRVHRAQAAGHGPIGHDGVIERYGLCESEQEDESDQVVELPLANREGKNK
                     GKTKKGRGRKSNFNAFSRRGLSDEEYEEYKKIREEKSGNYSIQEYLEDRQRYEEELAE
                     VQAGGDGGIGETEAEIRHRVFYKSKSGMRKQRQEERRQLGLVSGTEIRKRKPIDWTPP
                     KNDWSEDTRSVNYDEHISFEAPPSIWSRVVKFGSGWGFWVSSTVFITTTHVIPPGAKE
                     IFGEALNNVAVHRVGEFTQFRFSKKMRPDLTGMVLEEGCSEGTVCTIMIKRDSGELLP
                     LAVRMGAVASMKIQGKLMHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVC
                     GVHAAATKSGNTVVCAIQGGEGEATLEGGGQNKGHYAGHPILRYGNGPSLSTKTKFWK
                     STPQPLPPGTYEPAYLGGRDPRVDGGPSLQQVLRDQLKPFAEPRGRLPEAGLLEAAVE
                     TVTNAIEQVMDTPVAWSFSDACMSLDKTTSSGHPHHKKKNDDWNGSSFVRELGDQAAH
                     ANNMYELGKSMKPVYTAALKDELVKPDKVYNKIKKRLLWGADLGTVIRAARAFGPFCE
                     AIKPHVIKLPIKVGMNAIEDGPLIYAEHSKYKYHYDADYTAWDSTQNREIMMESFNIM
                     CKLTANPSLAAVVAQDLLSPSEMDVGDYVISVKDGLPSGFPCTSQVNSINHWILTLCA
                     LSEVTGLSPDVLQSQSYFSFYGDDEIVSTDVEFDPNKLTQVLKEYGLKPTRPDKTDGP
                     IVVKQQVDGLVFLRRTISKDAIGYQGRLDRNSIERQLWWTRGPNHDDPFETLVPHSQR
                     KVQLISLLGEAALHGEKFYRKIASRVIQEVKEGGLEIYIPGWQAMFRWMRFHDLSLWT
                     GDRDLLPDYVNDDGV"
     CDS             5388..7019
                     /function="structural"
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="BAE43833.1"
                     /translation="MMMASKDAPTNMDGTSGAGQLVPEASTAEPISMEPVAGAATAAA
                     TAGQVNMIDPWIMSNYVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLSHLAQMYNG
                     WVGNMKVRVLLAGNAFTAGKIIISCVPPGFAAQNVSIAQATMFPHVIADVRVLEPIEV
                     PLEDVRNVLFHNNDSTPTMRLICMLYTPLRASGSSSGTDPFVIAGRVLTCPSPDFNFL
                     FLVPPNVEQKTKPFSVPNLPLNVLSNSRVPSLIKSMMVSQDHGQMVHFQIGRVTLDGQ
                     LQGTTPTSASQLCKIRGTVYHATGGQGLNLTEIDGTPYHAFESPAPIGFPDLGECDWH
                     INASPANAFTDGSIIHRIDVAQDSTFAPHLGTIHYTNANYDANVSLICSLEWLSPPSG
                     GAPKVNPWAIPRYGSTLTEAAQLAPPIYPPGFGEAIVFFMSDFPIANGSDGLSVPCTI
                     PQEFVTHFVNEQAPTRGEAALLHYVDPDTHRNLGEFKLYPEGFMTCVPNSSGSGPQTL
                     PINGVFTFISWVSRFYQLKPVGTTGPVRRLGIRRS"
     CDS             7019..7666
                     /function="unknown"
                     /note="ORF3;
                     ORF3 encodes small basic protein of unknown function"
                     /codon_start=1
                     /product="basic protein"
                     /protein_id="BAE43834.1"
                     /translation="MAQAIIGAIAATAAGSAVGAGIQAGTEAALQHQRFQQDLTLQSN
                     TFKHDKEMLGLQVGASTALLQNSLSTRYNMLTNAGLSSSDAARLVVGAPATRVVDWNG
                     TRVSAPRSSATTLKSGGFMTIPTLYKGKQQQKAPTQAGFSNPNYGSVASSRTADWVSS
                     QNSTRSSLGPYHPSALQMTWVTPPGSSSTSTVSSVSTAPRYFNTDRLPLFANMRK"
ORIGIN      
        1 gtgaatgatg atggcgtcaa aagacgctat tgccgttgct gatgtcagca ataacaatgc
       61 taacaccaac aatgaaaaca ttgggtctcg ccttatggcg aggctccgcg gacgtatagg
      121 tccgcagcgt ggtgaaaaca ccacaaaaat aaaggatgcc aatatggcac tcgaccttct
      181 tcgccggtca caaacaccct ccccatcccg gcaagaccac cccccaaaag accaaagaga
      241 tcgtccaccg cgcactgcta tggaggtgag gaagacaatg gggtgggatg aagagccaag
      301 acagcaggag agcaccgtta aggcgtggtg cgacctcgca agggaggaaa aagaggagat
      361 aatgcgcaat aacgagaagc tctttgatgc tgggggggtt gctcctgcaa ttttaccaag
      421 cacattcgag agagccacgc cacacgaaag cactgatgaa tgtcaggcag tgacctggtc
      481 cgccagtgat ggcgtggaca ttggtgtgga cagcttaaaa acagtccgtg gccctccttg
      541 gaatatgtgc cccctgccac ctttggaggc tcgcaacagt ggacctgcaa gagagcccct
      601 tataggggat atggttgagt tttatgaggg ccatattttt cattatgcca tctatattgg
      661 acaaggaaag accattggtg tccactcacc acaggcagcc ttttctatac ctagaataac
      721 tatccatcca ttagtagctt ggtggcgggt gtgttacaca cccacagacc aacaaagact
      781 cacctatgac caattaagag aattggagaa tgagccatgg ccctatgcct caatcaccaa
      841 caattgttat gagttctgtt gcaaagtaat ggcacttgat gacacttggc tccaacgaaa
      901 attggtcacc actggaaaat ttaaccaccc cacacaggaa tggtcaaaag acactcctga
      961 ctttcaccaa gattcaaagc ttgagatggt tcgggatgct gtgctgtcgg ccatcaatgg
     1021 tcttgtgtca caacctttca aaaacattct gtcaaaaatc aagcctctga acctgattaa
     1081 cctattgtca aattgtgact ggacttttat gggagttgtg gagctgatag tgcttgtggc
     1141 cgaactattt gatgtatttt ggacaccgcc agacatctcc agttttatcg catcactatt
     1201 gcctgatttc cacctccagg gtccagagga tttggcaaag gatctggtcc cccttatatt
     1261 aggtggaatt ggccttgcaa ttggctttac aagggacaaa gtcaccaaag ttatgaagag
     1321 tgccgttgac ggattgcgct cggcaacaca acttggacaa tatggattag agatattctc
     1381 aattataaag aaatatttct ttgggggtga ccagacagag agaaccttgc gaggcattga
     1441 agatgctgtg atagacatgg aggtgctgtc cagtacaaat gtgacacaat tagttaggga
     1501 taagaaatca gccaaagcat acatgaatat attggacatt gaggaggaaa aagctaggaa
     1561 actttcagtc cgtagcgctg acccacacat agtaacctca gtaaataatc tgatatcccg
     1621 tatctccatg gcaaggtcag ctttggctaa agcccaggca gagatgacat cccgtatacg
     1681 cccagtggtg atcatgatgt gtggcccccc aggcattggt aaaacaaaag ctgctgagca
     1741 cttagccagc cggttggcca ctgaaatcag accaggtggc aaggttgggc tcgtgccccg
     1801 tgaatccata gaccattggg acggttatca tggtgaagag gtcctgttgt gggatgacta
     1861 cggcatgtca aagataacag aagattgtaa caagttacaa gccattgctg acactgcacc
     1921 actgtcactg aattgtgaca ggatagagaa caaaggcatg cagttcgtct ctgatgcaat
     1981 aattataaca accaatgctc ctggcccagc cccagtcgac tttgtcaatt taggacccgt
     2041 gtgcagacgg gtagattttc tagtctactg ttctgcgcct gaaattgaac aggcacggag
     2101 ggcccaccca ggcgatacca atgctataaa agacttgtat aagaaagact tctcacacct
     2161 aaagatggat ctggctccac aggggggctt tgataaccag ggtaacacgc cctttggcaa
     2221 gggtgtgatg aaacccacta cccttaacag actactaatc caagccactg cgctgaccat
     2281 ggaaaggcaa gatgaattcc aactccaagg catggtttac aactttgatg aggacagggt
     2341 ggcagcattc accagcttgg ctcgtgctaa cgggttgggg cttatcaata tggcaactct
     2401 gggcaagaaa ctaagaaatg ttaagaccat ggaagggctg cgcaatgcgc tggtggggta
     2461 ccggatagaa gagtgtgaca taatttggaa taccagagct tattcaatta agagtgatgg
     2521 caaaagtgtg acaatcaagg agaagcaaaa tcaaacctca tcccaacatc aagctgtcag
     2581 tacggccacc ctcgcgctct ccaggctacg ggctgcccga gcgatagcgt atgcatcctg
     2641 cctacaaagt gccgtccttt ccatacttca ggtggctggt tctgctgtag tggtgagcag
     2701 ggcggtgaaa cgcatgtttg gcacgagtac cgaacagccc gcattggagg gtggacataa
     2761 agagcacaac tgtagggtcc atcgggcaca ggccgcaggt catggtccca taggacatga
     2821 tggggtcatt gagcgctacg gtctgtgtga gagtgaacaa gaggatgaaa gtgatcaagt
     2881 cgtggaactg ccattagcca acagggaagg taaaaacaag ggtaagacca agaagggccg
     2941 tggccgcaag tccaatttta atgctttttc acgacgtggg ctcagtgatg aagagtatga
     3001 ggagtacaag aagatcagag aagaaaagag tggtaattac agcattcagg aataccttga
     3061 agatcgccaa cgctatgagg aagaacttgc cgaagtccaa gcaggcgggg atggtggaat
     3121 tggtgaaact gaggcagaaa tccgccaccg ggtcttctat aagtcaaaat ctggtatgag
     3181 gaagcagcgc caggaagaga ggcgacaatt ggggctcgtt agtggtactg agatccgcaa
     3241 gcgcaagcct atagattgga ccccccctaa aaatgactgg tctgaagaca ccaggtcagt
     3301 caattatgat gaacacatta gctttgaggc ccctccttca atttggagca gagttgtcaa
     3361 atttggtagc ggctggggat tttgggtgag ctcaacagtg ttcatcacta caacccatgt
     3421 tataccacct ggagctaagg agatttttgg ggaagccctt aataatgtcg ccgtccacag
     3481 agttggtgag ttcactcagt tccgtttctc caagaagatg agacctgacc tcacaggtat
     3541 ggtcttggaa gaaggatgct cagagggcac agtgtgcacc atcatgataa aaagggactc
     3601 tggtgagcta ctgccactcg ccgtgcgcat gggggcagtt gcttcaatga agattcaagg
     3661 gaagctcatg catggtcagt cggggatgct gctcactggt gccaacgcta aaggcatgga
     3721 ccttggcacc atacctggag actgtggagc gccttatgtc cacaagagag gaaatgattg
     3781 ggtggtgtgt ggagtacatg ctgcagccac aaaatcaggc aatacagtgg tgtgcgcaat
     3841 ccaaggtggt gaaggtgaag ccacactaga gggtggtggt caaaataaag gccactatgc
     3901 tggacaccca atactaaggt atgggaatgg accatctcta tcaactaaaa caaagttttg
     3961 gaagtcaacc ccacaacccc taccccctgg cacttacgaa ccagcctatc tggggggcag
     4021 agacccgaga gttgacgggg ggccatcttt acaacaagtg ctcagagacc agcttaaacc
     4081 ttttgctgaa cctcgtggta ggttaccaga agctgggcta ttagaggcag cagtggaaac
     4141 agtcaccaac gcaatagaac aggtcatgga cacaccagtg gcatggagct tcagcgatgc
     4201 ctgcatgtct ctagataaga ccaccagttc tggccacccc catcacaaaa agaagaacga
     4261 tgattggaac ggaagctcat ttgtacggga actgggagat caagctgctc atgccaacaa
     4321 catgtatgag cttggaaaat ccatgaaacc agtatacact gcagccctca aagatgagct
     4381 tgtgaagcca gacaaagtat acaataaaat taagaaaagg ctgttgtggg gagcggacct
     4441 cggcaccgtt atccgagctg ctagagcgtt tggtcctttc tgtgaagcta taaaacccca
     4501 tgtcatcaaa ctgcctatca aggttggcat gaatgctata gaagatggcc cattgatcta
     4561 tgcagagcac tccaagtata aatatcatta tgatgctgat tacacagctt gggactcaac
     4621 ccaaaacagg gaaatcatga tggagtcctt taacatcatg tgcaagctca cggccaatcc
     4681 ctccttggct gctgtggtcg cccaggattt gctctcccca tctgagatgg acgtgggaga
     4741 ctatgtgata agtgtcaaag acggtttacc atcaggtttt ccatgcacat cacaggttaa
     4801 cagcatcaac cactggatcc tcactctttg tgctctatca gaagtcactg gtctgtcccc
     4861 tgatgttctt cagtcacaat cctacttctc cttctatggt gatgatgaaa ttgtctccac
     4921 ggatgttgaa tttgacccaa ataaattgac acaggtgctc aaggaatatg gcctaaaacc
     4981 cacaagaccc gataaaactg atggacccat tgtggttaaa cagcaagtgg atggcctggt
     5041 cttccttcgg cgcaccatct caaaggacgc cattgggtac caggggcggc ttgaccgcaa
     5101 ttccattgaa agacaacttt ggtggacccg tggcccgaat catgatgacc catttgaaac
     5161 tttggttcca cactcacaaa gaaaggtcca gttaatatcc ctattaggtg aagcagcact
     5221 ccatggtgag aaattctaca gaaaaatagc aagcagagtc atccaggagg taaaggaagg
     5281 tgggctagaa atctacatcc ctggatggca agccatgttc cgctggatgc gtttccatga
     5341 tctgagtttg tggacaggag atcgcgatct cctgcccgat tatgtaaatg atgatggcgt
     5401 ctaaggacgc cccaacaaac atggatggca ccagtggtgc tggtcagctg gttccagagg
     5461 caagtacagc tgaacctata tcaatggagc ctgtggctgg tgctgctaca gcagcagcaa
     5521 ccgcaggtca agttaatatg attgacccct ggattatgag taattatgtt caagcccctc
     5581 aaggagagtt cacaatttcc cctaacaaca ctcccggaga tatattgttt gatttacaat
     5641 tagggcccca tttgaaccca ttcctatcac acctggccca gatgtacaat ggatgggttg
     5701 gtaatatgaa agttagggtg ctgctcgctg gtaatgcctt cacagcgggt aaaataataa
     5761 ttagttgtgt tccccctggt tttgcagccc aaaatgtctc aatagcccaa gcaacaatgt
     5821 ttccccacgt tattgcagat gtgagagtgc ttgaaccaat tgaagttcca ttagaggatg
     5881 tgaggaatgt gctcttccac aataatgact ccactccaac tatgagattg atttgtatgt
     5941 tgtatacccc tctccgtgct agtggcagct cctctggcac tgatccattt gtcatagctg
     6001 gacgggtcct cacctgtccc agtcctgact ttaacttttt gtttcttgtg ccccccaatg
     6061 ttgagcagaa aactaaacca tttagtgtac ctaatctccc cctcaatgtt ctctcaaatt
     6121 ctagggttcc ctctttgata aagtctatga tggtctccca agaccatggg cagatggtgc
     6181 acttccagat tgggagggtc acattagatg gacagctcca aggtaccact cccacttcag
     6241 ctagtcagct ctgcaaaatt cgagggacgg tttaccatgc aactggtggc caagggctta
     6301 atttgactga gattgatggg actccctacc atgcatttga gagccccgcc ccaattggtt
     6361 tccccgattt gggtgagtgt gattggcata ttaacgcatc tcctgctaat gctttcacag
     6421 atggtagtat catacacaga attgatgtgg cccaggattc cacttttgct ccccatctag
     6481 gcactatcca ctataccaac gctaactatg atgccaatgt tagcctaatt tgttcacttg
     6541 aatggctctc ccccccaagc gggggtgctc caaaggttaa cccatgggct attcctcgat
     6601 acggttcaac cctgactgag gctgcccagt tggccccacc aatataccct cccggatttg
     6661 gcgaggcaat tgtcttcttt atgtctgatt tccccatagc taatggttca gatggtttga
     6721 gtgtcccttg cactatacca caagagtttg tgacccattt tgttaatgaa caagcaccca
     6781 ctcgtggtga ggctgcactg ttgcactatg ttgaccctga cacacatcgc aatttgggcg
     6841 aattcaaatt ataccctgaa ggttttatga cttgtgtccc caactccagt ggtagtggac
     6901 cccagacact gcctatcaat ggggttttca ctttcatttc ctgggtttct cgcttctatc
     6961 aattaaagcc tgtgggaacg accggtccgg tccgtaggct aggcattcgg aggtcataat
     7021 ggcccaagcc ataattggag caattgctgc aacggctgct ggtagtgctg tgggagctgg
     7081 catccaggct ggtactgagg ctgcgctcca acaccagcgc tttcagcagg atctcacgtt
     7141 gcaaagtaac accttcaaac atgacaaaga gatgcttggg ttgcaggttg gggcgtctac
     7201 tgcacttttg caaaatagcc tcagcactcg ctacaatatg ctaactaatg ctggcctatc
     7261 ctcctcagat gcggcacggt tggtggttgg tgctccagcc acgcgtgttg tggattggaa
     7321 cggcaccagg gtgtcagctc cacggtcatc tgccactacg ttgaagtctg ggggtttcat
     7381 gacaatacca accctctaca agggcaagca acagcagaaa gcacccacac aggccggctt
     7441 ttcaaatcct aactatggct cagtagcctc ctctagaact gctgactggg tttcttctca
     7501 aaattcaacc cggtcttctc ttggccctta tcatcctagt gcattacaga tgacatgggt
     7561 aaccccacct ggttctagct ccacctctac tgtttcttct gtgtctactg cacctaggta
     7621 ttttaatact gataggttgc ctctattcgc aaatatgagg aaatgatttt tgtaatatga
     7681 aatgtgggca tcatattcaa ttagatctaa ttatattttg atttggtttg atttggtcat
     7741 gatgtt
//