Typing tool

Complete norovirus genomes

AB083780  GII.22
 GII.P22

Length: 7,560 | 3 CDS

ORF1: 5..5140
ORF2: 5121..6746
ORF3: 6746..7507
LOCUS       AB083780                7560 bp    RNA     linear   VRL 10-JAN-2009
DEFINITION  Norwalk-like virus genomic RNA, complete genome, strain: YURI.
ACCESSION   AB083780
VERSION     AB083780.1
KEYWORDS    .
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Kuzuguchi,T., Saito,H. and Kawamoto,H.
  TITLE     Complete sequence determination for genogroup 2 (G2) Norwalk virus
            (NV) represented most current strain of Japan
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Kuzuguchi,T., Kawamoto,H. and Saito,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-2002) Contact:Tsuyoshi Kuzuguchi Gifu Prefectural
            Institute for Bio-Industrial Technology, Molecular Microbiology;
            Hachiyacho Kamihachiya 3481-2, Minokamo, Gifu 505-0004, Japan
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /strain="YURI"
                     /host="Homo sapiens"
                     /db_xref="taxon:95340"
                     /country="Japan: Akita, Yuri"
     CDS             5..5140
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAF38393.1"
                     /translation="MKMASNDAATATAGKTSTNSEIHNQDVNPTSNLFANMSVGLRRA
                     LGARPKQPVPRVPSPNKERGLGTTPRALSPNKGGRTNIPPVPPPPPNGEDIIIKYTKQ
                     DDVVEGVPTVATVDVSPTHNTAYSVPPLDLREKVDAKEPLTGSILEMWDGEIYHYGLY
                     VEKGLVLGVHKPPAAISFARIELTPLSLYWRVVYTPPYLIAPETLRKLHGESFPYTAF
                     DNNCYSFCCWVLDLNDSWLNRKYVSRTTGFYRPYQEWNRKPLPTMDEGKLKKVANVLL
                     CGLSGLFTRPIKDLIGKLRPLNILNIITNCDWTFPGVVEALILLAELFGIFWTPPDIS
                     TFIASLLGDYEMQGPEDIAVEVVPVILGGIGMVLGFTKERIGRLLSSAASSLRACREI
                     GNYGIEVVKLMMKWFFPTKDEANEMDMVRAIEDAVLDFEAIQNNHMTALLKDKNSLAT
                     FLRELDMEEEKARKLSTKSASPDIIGTINALLARIAAARSLVHKAKEEMSSRMRPVVI
                     MISGRPGIGKTHLARDLAKKMAATLSGDQRVGLVPRNGVDHWDAYKGERIVLWDDYGM
                     SNPVTDALRLQELADTCPLTLNCDRIENKGKVFDSDTIIITTNLANPAPLDYVNFEAC
                     SRRIDFLVYADSPSVDKAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPH
                     GKGVMKTLTTHSLIARATGLLHERLDEFDLQGPELPVYNFDHNRVAAFRRLAADNKYG
                     LMETMKVGNKLKGVRNLEQLKDALKDISIKPCRIVYNSMAYDLDSNGSGRVNVKKVAD
                     HKVQTNNELNSALNNLRGARVRYYVKCVQEMVYSLLQIAGAAFVTSRMTRRLNIGSIW
                     ARPEQQVETAKEPPAPPTEDWTITPTNTVQEGKKGKNKSGRGKKHTAFSSKGLSDEEY
                     DEYKRIREERQGKYSIEEYLQDRDRYYEELAIARATEENFCEEEEIKIRQRIFRPTRK
                     QRKEERATLGLVTGSEIRKRNPDDFKPKGKLWADDDRSVNYNEKIDFEAPPSLWSRIV
                     NFGSGWGFWVSSNLFITSTHVIPPNMIEAFGVPIGQIQVHRSGEFCKMRFPKAIRPDV
                     SGMILEEGAPEGTVVTILIKRTTGELMPLAARMGTHATMKIQGKMLGGQMGMLLTGSN
                     AKNMDLGTIPGDCGCPYVYKRGNDWVVIGVHTAAARGGNTVICATQGPDGEATLEGGD
                     NHGTYCGAPILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGKDPRVKGGPSLQQ
                     VMRDQLKPFTAPRGRPPRPAILEAAKETICNVLEQTIDPPQKWSYAQACASLDKTTSS
                     GHPHHMKKNDNWNGESFTGVLADQASKANLMYEQGKHMQPVYTAALKDELVKTSKVYE
                     SIKKRLLWGSDLGTMIRCARGFGGLMDEMKANCVNLPIRVGMNMNEDGPIIFEKHSKY
                     KYHYDADYSRWDSTQQRHILGAALEIMVRFSAEPELAQIVSEDLLAPSVVDVGDFKIA
                     INEGLPSGVPCTSQWNSISHWLITLCAISEVSGLSPDVVQSNSCFSFYGDDEIVSTDI
                     KLDPMKLTNKLKEYGLIPTRPDKTEGPLIIKENLEGLTFLRRDVCRDPAGWYGKLDQS
                     SIMRQLFWTKGPNHDDPNETMIPHSQRPIQLMSLLGEAALHGPAFYKKVSKLVITELK
                     EGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     CDS             5121..6746
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="BAF38394.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINTEVMALEPVAGGAIAAPLTGQ
                     TNIIDPWIRNNFVQAPNGEFTISPRNSPGEILLNMELGPELNPFLAHLSRMYNGFAGG
                     MEVQVLMAGNAFTAGKVIFAAVPPHFPVENLSPPQITMFPHIIIDVRTLEPVLLPMPD
                     VRNQFFHYNQVNEPRMRLVAMLYTPLRSNGSTEDVFTVSCRVLTRPSPDFEFNYLVPP
                     TVESRTKPFTLPVLTIGEMTNSRFPAPIDMLYTSPNGNVVVQPQNGRCTLDGELQGST
                     QLVPANVCAFRGKITARIVDQAAHQWHMQIDNPNGTLFDPTEDVPAPLGTPDFKAKIF
                     GVISQRNDYNDGSQGPANRAHDAVVPTTSAKFTPKLGSILVGTWENNDIETQPSKFTP
                     VGLLEMNDFNQWSLPNYSGALTLNMGLAPAVFPTFPGEQILFFRSFIPLKGGHGNPAI
                     DCLLPQEWIQHFYQESAPSQTSVALIRYVNPDTGRVLFEGKLHRQGFITIAKSGDGPI
                     VVPPNGYFRFDSWVNQFYSLAPMGNGNGRRRIQ"
     CDS             6746..7507
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BAF38395.1"
                     /translation="MAGAFIAGLAGDIVTNGVGSLVNAGANAINQKVDFENNKYLQSA
                     SFAHDKEMLKAQIEATKQLQSDMIAIKQSVLSAGGFAPADAARGSVNAPMTKVLDWGG
                     TRYWAPNSTSTTMYSGGFTGQPVHRPTPNFSMKSKPVPSVASSSHKSNSTASTQLGSV
                     SSGSSRSSVSTATSSLPSTTRTVEWVRQQNRELEPHMPGSLRTAFVTPPSSTASSSGI
                     VSTVPKGVLDSWTPVFNTHRQPLFAYLHKRGESKV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctgc cactgcgact gctggcaaaa ccagcacaaa
       61 cagtgaaatt cacaatcaag atgtaaaccc tacatcaaac ctctttgcca acatgtctgt
      121 tggcttaagg agagccctgg gggcgaggcc aaaacagccc gtccccaggg tcccctcccc
      181 caataaggag agagggctcg gtaccacccc tagagctctc tcccccaaca agggaggaag
      241 aaccaacatc cccccagtac cgcccccacc acccaacggt gaggacataa tcatcaaata
      301 caccaaacaa gatgatgtgg ttgaaggggt gcccaccgtt gccacggtgg acgtttctcc
      361 cacgcacaac accgcctaca gtgtacctcc cttggaccta agagagaagg ttgacgcaaa
      421 ggaacccctg acaggttcga tacttgaaat gtgggatggg gaaatctacc actatggact
      481 atatgtggag aaaggcttgg tccttggtgt gcacaaacct ccagctgcca taagttttgc
      541 acgcatagaa ctcactcctc tttctctata ctggagggta gtttacaccc caccttacct
      601 aatagcccca gaaaccctca ggaaactcca tggggagtca ttcccataca cagcttttga
      661 taataactgc tattccttct gctgttgggt actggatctg aacgattctt ggctcaatag
      721 gaagtatgta tcaaggacca cgggtttcta caggccctac caagagtgga ataggaaacc
      781 cctaccaacc atggatgagg gaaagttaaa gaaggtggcc aatgtgctcc tgtgtggcct
      841 ctctgggctc ttcactaggc ccatcaagga tctcatagga aaactgaggc cactgaacat
      901 actcaacatc atcaccaact gtgattggac atttcccggg gttgtggagg ctctcatact
      961 gcttgcagaa ctctttggga tcttttggac accaccagat atttccacct tcatagcatc
     1021 gctgctgggt gattatgaaa tgcagggccc tgaggatatc gcggttgagg tcgtgccggt
     1081 gatcctcggt ggcataggta tggtacttgg attcaccaaa gaaaggatcg gccgactgtt
     1141 gagctcggct gcgtcttcgc tcagagcatg cagggagatc ggtaactacg ggattgaggt
     1201 ggtgaaactg atgatgaagt ggtttttccc caccaaggat gaggcaaacg agatggacat
     1261 ggtgagggca atagaggatg ctgtgctcga ttttgaagct atacagaaca accatatgac
     1321 agcattgctc aaggacaaaa acagtctagc aaccttcctc agggagctag atatggaaga
     1381 ggagaaggcg cggaagctgt caacaaaatc cgcgtcccca gatattattg gtaccataaa
     1441 tgcccttcta gccagaattg ccgctgctag gtccctagtc cacaaggcca aagaagaaat
     1501 gtcatctagg atgcgtcctg ttgtcatcat gatctctggt cggcccggaa taggaaagac
     1561 acatctggcc cgtgacctgg ccaagaagat ggcggcaacc ctctcaggcg atcagagggt
     1621 ggggctcgta ccgagaaatg gtgttgacca ttgggatgca tacaaagggg agaggattgt
     1681 gctttgggac gactacggta tgagcaaccc tgtgaccgat gcactgcgac ttcaggagct
     1741 agctgacacg tgtcccctaa cacttaattg tgacagaata gagaataagg ggaaagtgtt
     1801 tgacagtgac accataatta ttaccaccaa tctggctaat cctgctcctc tagactatgt
     1861 taattttgaa gcttgctccc gccgtatcga tttccttgtt tacgctgatt ccccctcagt
     1921 tgacaaagca aagagagact tccctggtca accagacatg tggaaagatg cattcaagtc
     1981 agacttttca cacataaaac tccagttggc gccacaaggg ggctttgaca agaacgggaa
     2041 tactcctcat gggaagggtg tcatgaaaac actgacaaca cactccctca ttgcccgcgc
     2101 cactggcctc ttacacgaga ggttggatga gttcgaccta cagggacctg agctgcctgt
     2161 gtacaacttt gaccacaaca gggtggctgc gttcaggaga cttgcagctg acaacaagta
     2221 tggcctcatg gagaccatga aagtgggcaa caaattaaag ggagtcagga atctggagca
     2281 actcaaggac gctctaaaag acataagtat caaaccttgt agaatagtct acaactcgat
     2341 ggcttacgac ctcgactcaa acggatcagg gagagtcaac gttaaaaagg ttgcagatca
     2401 caaggtccaa accaacaatg agctcaactc cgcgctcaac aatctgcgtg gtgctagagt
     2461 gagatactat gtcaagtgtg ttcaagagat ggtgtactct ctcctccaga tcgctggtgc
     2521 ggccttcgtc acttcaagga tgacacggag actgaacatc ggcagtatct gggccagacc
     2581 agaacaacaa gtggagactg ctaaggaacc cccagccccc ccaactgaag attggactat
     2641 aacaccaaca aacacagttc aggaaggtaa gaaaggtaag aacaagagtg gtagaggcaa
     2701 gaaacacacc gccttctcca gcaagggcct cagtgatgaa gagtacgatg agtacaagag
     2761 aatcagggag gagagacaag gaaagtactc tatagaggaa taccttcagg acagggaccg
     2821 gtattatgag gagctagcca tagccagagc aacagaagag aacttttgtg aggaggaaga
     2881 gataaaaatt aggcagagga tcttccgccc caccaggaaa caacgtaagg aggagagagc
     2941 aactctgggc ctagttacgg gcagtgagat aaggaagagg aacccagatg atttcaagcc
     3001 aaagggaaaa ctgtgggctg acgacgaccg cagtgtgaac tacaatgaga agatagactt
     3061 tgaagcgccc cccagccttt ggtcccgaat agtgaacttc ggatcaggct ggggcttctg
     3121 ggtgtcatct aacttgttca ttacatcaac tcatgtcatc cccccaaaca tgattgaggc
     3181 ctttggtgta ccaataggtc aaatacaagt acacaggagt ggtgagttct gcaaaatgag
     3241 gttccctaaa gctataagac ccgatgtctc aggtatgatc cttgaggaag gagcccccga
     3301 gggaacagtg gtgaccatcc tgatcaagag aacaactggt gaactcatgc cactggcggc
     3361 ccggatgggc actcatgcca ccatgaaaat acaagggaag atgcttgggg gtcaaatggg
     3421 catgttactc acagggtcca atgccaaaaa catggatctt ggcactatcc ccggggactg
     3481 tggctgtcct tatgtgtaca agagaggcaa tgattgggtg gttatagggg tgcataccgc
     3541 agctgccaga ggcggcaaca cagtgatctg cgccacccag ggaccagatg gtgaggccac
     3601 gcttgaaggg ggggacaacc atgggactta ctgtggtgca ccaatacttg gaccagggaa
     3661 tgcaccaaaa ctcagcacca agacgaagtt ctggaggtca tccaacgccc cactcccacc
     3721 tggcacttat gagcctgcct acttaggtgg gaaggaccca agagtcaagg gggggccatc
     3781 tctgcagcaa gtcatgaggg atcaactcaa gcccttcacc gctccccggg ggaggccacc
     3841 acgaccagcg attctggagg ctgctaaaga gaccatttgc aatgtgcttg aacaaaccat
     3901 tgatccaccc caaaaatggt cttatgcaca agcctgtgcc tcattggata agacaacatc
     3961 gagtggtcat cctcaccaca tgaaaaagaa tgacaactgg aatggagagt ccttcactgg
     4021 cgtgttggct gaccaagctt ccaaggcaaa cctcatgtac gaacagggaa aacacatgca
     4081 gcctgtgtac actgctgccc tcaaggacga gctcgttaag accagcaagg tttatgagag
     4141 tatcaagaaa aggctactat ggggctcaga tttgggcaca atgattcgct gtgctagggg
     4201 ttttggtggt cttatggatg aaatgaaagc aaattgtgta aacttaccaa tcagagttgg
     4261 catgaacatg aatgaggatg gacccattat ttttgaaaag cattcaaagt ataagtacca
     4321 ttatgatgct gactactcta ggtgggactc aacccaacag aggcacatct tgggagctgc
     4381 ccttgaaata atggtcaggt tctcagctga acctgagttg gcacagattg tgtctgaaga
     4441 cctcctagcc cccagtgtgg tggacgttgg tgactttaaa atcgccataa acgagggttt
     4501 gccctctggg gtgccgtgta catcacagtg gaattcaatc tctcattggc taataacact
     4561 gtgtgccata tcagaagtct cagggttgtc accagatgta gtacaatcaa actcctgctt
     4621 ctctttctac ggggatgatg aaatagtcag cactgacatc aagttagatc ccatgaaact
     4681 aactaacaag ctgaaagagt acgggctgat cccaacaaga ccagataaga cagagggacc
     4741 actcataatt aaagagaacc ttgaaggttt gactttcctg agaagggacg tgtgccggga
     4801 cccagctggt tggtatggaa aacttgacca atcctcgatc atgagacaac tgttctggac
     4861 caagggaccc aatcatgatg accccaatga gacaatgatc ccacactctc agaggcccat
     4921 acaactgatg tctctactag gggaggcagc actgcacgga ccagccttct acaagaaagt
     4981 cagcaaattg gttatcactg agctcaaaga gggtgggatg gatttctatg tgccaagaca
     5041 ggaacctatg ttcagatgga tgagattctc tgacctcagc acttgggagg gcgatcgcaa
     5101 tcttgctccc gaaggtgtga atgaagatgg cgtcgaatga cgctgctcca tctaatgatg
     5161 gcgctgccgg cctcgttcca gagatcaaca cagaggttat ggcactggag ccagttgctg
     5221 gaggagctat cgcagcccct ctcactggac aaacaaatat aattgatccc tggattagaa
     5281 ataattttgt gcaagcccca aatggtgaat tcaccatatc tcctagaaac tccccagggg
     5341 aaatcctgtt aaatatggaa ttaggacctg agttgaaccc tttcttggct cacctctcca
     5401 gaatgtacaa tggttttgca ggtggtatgg aggtacaggt attgatggcg gggaatgctt
     5461 tcaccgctgg aaaggtcatc tttgctgcag ttccacccca ttttccagtg gagaatttaa
     5521 gcccccccca aataactatg ttccctcata taattataga tgttaggacc ctagaaccag
     5581 tcttgttgcc catgcccgat gtgagaaatc aattcttcca ttacaatcag gtgaacgaac
     5641 ccaggatgcg gttagtggcc atgctctaca cacccttgag atcaaacgga tccactgaag
     5701 acgttttcac ggtgtcctgc agggtgttga ccaggccttc accggatttt gagttcaatt
     5761 acctggtgcc cccaactgtg gagtcaagaa caaaaccctt caccttacct gtcctcacaa
     5821 ttggagagat gacaaattca cgcttccccg cacccataga tatgctttac actagcccca
     5881 atggtaatgt agttgtacaa ccacaaaatg gtagatgcac ccttgatggt gagcttcagg
     5941 gaagcacaca actagtccca gcaaatgtgt gtgcatttag aggtaaaatc acagcaagga
     6001 tcgttgatca ggcagcacac cagtggcata tgcagattga caatcccaat gggacactct
     6061 ttgatccaac tgaggatgtg cctgcacccc ttggaacccc tgacttcaaa gccaagatat
     6121 tcggggtcat atctcaaagg aatgattaca atgatggtag tcagggacct gcaaacagag
     6181 cacatgatgc cgtggtaccc accacgtcag ctaaattcac cccaaaattg ggttccatat
     6241 tggtgggcac ttgggagaat aatgacatag aaacacagcc ttccaaattc actccagttg
     6301 gcctgctcga gatgaatgac ttcaatcagt ggtcacttcc aaattattca ggggccctaa
     6361 ccctcaatat gggccttgca ccagcggtct tcccaacttt ccctggtgag cagattcttt
     6421 tcttcagatc ttttatccca cttaaaggcg gccacggcaa tccagccatc gactgccttc
     6481 tcccgcaaga gtggatacag cacttctacc aggagtctgc cccctcccaa accagtgttg
     6541 ctctgattag gtatgtaaac cctgatacag gacgagtcct gtttgaggga aagttgcata
     6601 ggcagggatt cataaccatt gcaaagtcag gagatggacc aattgttgtg cccccaaatg
     6661 gatattttag gtttgactct tgggtgaatc aattttactc acttgccccc atgggaaacg
     6721 gaaacgggcg cagaaggatc cagtaatggc aggagcattt atagcaggat tggctggtga
     6781 cattgtcaca aatggggtgg ggtcattagt taatgcaggg gctaatgcta tcaatcaaaa
     6841 agttgatttt gaaaataata aatatcttca atcagcatca tttgctcatg ataaggagat
     6901 gcttaaagca caaattgagg ccactaaaca actccagtct gacatgattg ccatcaaaca
     6961 aagtgtgtta tccgctggcg ggttcgcacc tgcggacgcg gcaaggggat cagtcaatgc
     7021 acccatgaca aaggtccttg attggggtgg cactagatat tgggcaccaa attcgacctc
     7081 cacgaccatg tactctggtg gttttacagg ccaaccagtg cataggccga cgccaaattt
     7141 ttcaatgaag agcaagcccg tgccgagtgt tgcatcatcc tcccacaagt ccaattccac
     7201 agcatcaacc cagctcggct ctgtgtcgtc tggttcgtcc agatccagcg tctccactgc
     7261 aactagctca ctcccatcca caaccagaac agtggagtgg gtcaggcagc agaacagaga
     7321 gctggaaccg cacatgcccg gatcgctgag gacggccttt gtcacaccgc catctagcac
     7381 ggcctctagc tcgggcatag tctcaaccgt gcccaaaggt gttttggact cctggacgcc
     7441 tgtgtttaac acacataggc agccgctttt cgcatacctc cataagaggg gggagtcaaa
     7501 agtttagtga aaagaaagat ttttctatga ttaggttaat gatttggttt tctttcttgc
//