Typing tool

Complete norovirus genomes

AB081723  GI.6
 GI.PNA1

Length: 7,693 | 3 CDS

ORF1: 5..5371
ORF2: 5355..6977
ORF3: 6977..7606
LOCUS       AB081723                7693 bp    RNA     linear   VRL 14-MAR-2019
DEFINITION  Norwalk-like virus genomic RNA, complete genome, strain: WUG1.
ACCESSION   AB081723
VERSION     AB081723.2
KEYWORDS    .
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Kojima,S., Kageyama,T., Oka,T.,
            Hoshino,F., Fukushi,S., Shinohara,M., Uchida,K., Suzuki,Y.,
            Gojobori,T. and Takeda,N.
  TITLE     Phylogenetic analysis of the complete genome of 18 Norwalk-like
            viruses
  JOURNAL   Virology 299 (2), 225-239 (2002)
   PUBMED   12202225
REFERENCE   2  (bases 1 to 7693)
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Takeda,N., Kageyama,T.,
            Fukushi,S. and Kojima,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAR-2002) Contact:Kazuhiko Katayama National
            Institute of Infectious Diseases, Department of Virology II; 4-7-1
            Gakuen, Musashi-murayama, Tokyo 208-0011, Japan
COMMENT     On Mar 18, 2019 this sequence version replaced AB081723.1.
FEATURES             Location/Qualifiers
     source          1..7693
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /strain="WUG1"
                     /db_xref="taxon:95340"
                     /country="Japan:Wakayama"
     gene            5..5371
                     /gene="ORF1"
     CDS             5..5371
                     /gene="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="BAC11839.1"
                     /translation="MMMASKDVVATNVASNNNANNTSATSRFLSRFRGLGGGASPPNP
                     IKIKSTEMALGLIGKTTQEVAGTSDLPPKQQRDRPPRTQEEVQYGLGWTERPMDQNVK
                     SWEELDTTTKEEILDSHKEWFDAGGLGPCTMPSTCEQAKDDSPPGEQVKWSVRDGVNL
                     GVNRLTTVSGPEWNLCPLPPIDLRNMEPASEPTIGDMIEFYEGHIYHYSIYIGQGKTV
                     GVHSPQAAFSVARVTIQPIAAWWRVCYIPQPKHRLSYDQLKELENEPWPYAAITNNCF
                     DFCCQIMNLEDTWLQRRLITSGRFHHPSQSWSQQTPEFQQDSKLELVRDAILAAVNGL
                     VSQPFKNFLGKLKPLNVLNILSNCDWTFMGVVEMVILLLELFGVFWNPPDVSNFIASL
                     LPDFHLQGPEDLARDLVPVILGGIGLAIGFTRDKVTKVMKSAVDGLRAATQLGQYGLE
                     IFSLLKKYFFGGDQTERTLKGIEAAVIDMEVLSSTSVTQLVRDKQAAKAYMNILDNEE
                     EKARKLSAKNADPHVISSTNALISRIAMARSALAKAQAEMTSRMRPVVIMMCGPPGIG
                     KTKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKIQDDCNK
                     LQAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFINLGPVCRRVDFLVY
                     CSAPEVEQIRKVSPGDTSALKDCFKPDFSHLKMDLAPQGGFDNQGNTPFGKGVMKPTT
                     INRLLIQAVALTMERQDEFRLQGKMYDFDDDRVSAFTTMARDNGLGILSMAGLGKKLR
                     GVTSMEGLKNALKGHKIGMCTIKWQAKVYSLESDGNNVNIREEKNVLTQQQQSVCAAS
                     IALTRLRAARAVAYASCIQSAITSILQIAASALVVNRAVKRMFGTRTAALSLEGPPKE
                     HKCRVHQAKAAGKGPIGHDDMVEKYGLCETEEDEEVVHTEMPSATIEGKNKGKNKKGR
                     GRKNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDG
                     GIGETEMEIRHRVFYKSKSKKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDDR
                     EVDYNERINFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLASI
                     AIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIA
                     SMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKS
                     GNTVVCAVQASEGETTLEGGDKGHYAGHEIVKHGCGPALSTKTKFWKSSPEPLPPGVY
                     EPAYLGGRDPRVSGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSSLEQVMD
                     TPVPWSYSDACQSLDKTTSSGFPHHKRKNDDWNGTAFIRELGEQAAHANNMYEQAKSM
                     KPMYTAALKDELVKPEKVYQKVKKRLLWGADLGTVIRAARAFGPFCDAIKSHTIKLPI
                     KVGMNSIEDGPLIYAEHSKYKYHFDADYTAWDSTQNRQIMTESFSIMCRLTASPELAS
                     VVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDV
                     IQSMSYFSFYGDDEIVSTDIEFDPAKLTQVLKEYGLKPTRPDKSEGPIIVRKNVDGLV
                     FLRRTISRDAAGFQGRLDRASIERQIYWTRGPNHSDPFETLVPHQQRKVQLISLLGEA
                     SLHGEKFYRKISSKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVN
                     DDGV"
     gene            5355..6977
                     /gene="VP1"
     CDS             5355..6977
                     /gene="VP1"
                     /note="ORF2;
                     structure protein VP1"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="BAC11840.2"
                     /translation="MMMASKDAPTSPDGASGAGQLVPEANTAEQISMDPVAGASTAVA
                     TAGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNG
                     WVGNMRVRILLAGNAFTAGKIIICCVPPGFDARILTIAQATLFPHLIADVRTLEPVEL
                     PLEDVRNVLYHNSSQPQPTMRLVAMLYTPLRTGGGSGGTDAFVVAGRVLTCPAPDFSF
                     LFLVPPSVEQKTRVFSVPNIPLKDLSNSRVPVPIQGMFMSPDVNQSVQFQNGRCQIDG
                     QLQGTTPVSLSQLCKIRGKTSSNARVLNLSEVDGTPFIPLESPAPVGFPDLGGCDWHV
                     NFTFQAQNQDPSQSVTFATNDASFVPYLGSISPHNGGDFHAGDIIGSLGWISAPSDNT
                     QLNVWTIPKYGSSLPDVTHLAPAVFPPGFGEVILYFYSTFPGSGQPSQLQVPCLLPQE
                     FITHFCNEQAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCVPNSVSSGPQTLPIN
                     GVFVFVSWVSRFYQLKPVGTASAARRLGLRRI"
     gene            6977..7606
                     /gene="VP2"
     CDS             6977..7606
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="BAC11841.2"
                     /translation="MAQAVIGAIAASAAGSILGAGIQAGAEAGLQAQRYQQDLQLQQN
                     SFKHDREMLGYQVQASNALLAKNLNTRYALLQAGGLSSADAARAVAGAPVTRIVDWNG
                     TRIAAPTSSTTTLRSGGFMAVPIPLSSKTKQPVMSGQDNPNYAASSISRTASWVQSQN
                     SMRSVSPFHSDALRTVWVTPPGSSSTSSVQSSFYGVFNTDRLPLFANRR"
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcgactaat gttgcaagca acaacaatgc
       61 taacaacact agtgctacat ctcgattttt atcgagattt aggggtttgg gtggtggcgc
      121 gagccccccc aaccccataa agatcaaaag cacagaaatg gccttgggtt taattggcaa
      181 gacaacccaa gaggtggcag ggaccagtga cctaccaccc aaacagcaga gagaccgtcc
      241 ccccaggacc caggaggaag ttcagtatgg tttggggtgg actgaaaggc ccatggacca
      301 aaatgtcaag tcatgggagg agcttgacac cacaaccaag gaagagatct tggacagtca
      361 taaagagtgg tttgatgccg gcggcttagg cccatgcaca atgccctcaa cttgtgaaca
      421 agccaaagat gacagcccac ctggtgaaca ggtcaaatgg tcagtgcgtg atggagttaa
      481 tcttggggtg aatcgcctca caacggtgag tggtcctgaa tggaacctct gtccgctacc
      541 ccccattgac ctaaggaata tggagccagc tagtgaaccc accattggag acatgataga
      601 gttttatgaa ggccatatct atcactactc catatacatt gggcagggta agacagttgg
      661 tgtgcattcc ccacaggcgg cattctcagt ggctagagtg actatccaac ctatagccgc
      721 ttggtggagg gtttgttata taccccaacc taaacatagg ttgagttatg atcaactcaa
      781 agaattggaa aatgaacctt ggccatatgc agctatcacc aacaattgct ttgacttttg
      841 ctgccaaatt atgaatcttg aggacacatg gttacaaagg cggctaatca catcgggcag
      901 atttcatcac ccatcccagt cttggtcaca gcaaacccct gaatttcagc aggatagcaa
      961 gctggaacta gttagggatg ctatattggc cgcagtgaat ggcctagttt cacaaccctt
     1021 caagaatttc ctaggtaagc tcaagcccct taatgtatta aacatcctat ctaactgtga
     1081 ctggactttt atgggggtgg tagagatggt tatactgctc cttgagctct ttggcgtgtt
     1141 ctggaacccg cccgatgtat ccaattttat agcgtccctt cttcctgatt tccacctcca
     1201 ggggcccgaa gatctggccc gggatctggt tccagttatt cttggtggta tagggctagc
     1261 cattgggttc accagagaca aggtcactaa ggtcatgaag agtgccgtag atggcctccg
     1321 ggccgctacg cagttgggac agtatgggtt agaaatattc tcactcctta agaagtattt
     1381 ctttggtgga gaccagactg aacggaccct caaaggcatt gaagcagcag taatagacat
     1441 ggaggtgttg tcctccacat cagtgacaca gctggtgaga gacaagcagg cagccaaggc
     1501 ttacatgaac attctggata atgaagagga aaaagcaaga aagctctctg ccaagaatgc
     1561 tgaccctcat gtaatatcct caacaaacgc cctaatatcg cgtatagcta tggcgcggtc
     1621 cgcattggcc aaggctcaag ctgaaatgac cagtcgaatg aggccagtcg tcattatgat
     1681 gtgtggcccc cctgggattg ggaagactaa agctgcggaa cacctggcaa aacgactggc
     1741 caatgagatc agacctggtg gcaaagtggg gctggtgcca cgtgaggctg ttgaccactg
     1801 ggatggctat catggtgagg aagtgatgct atgggatgat tatggtatga caaaaataca
     1861 agatgactgc aataagctcc aggctattgc tgattctgcc ccactcactc tgaattgtga
     1921 taggatagaa aataaaggga tgcaatttgt gtcagatgca atagtcatca ctaccaatgc
     1981 cccagggccc gcccctgtgg acttcatcaa tcttggcccc gtgtgcagac gggttgattt
     2041 cctggtttac tgctccgccc cagaggtaga acagataagg aaagtcagcc ctggtgacac
     2101 atcagcatta aaggattgct tcaagccaga cttctcccat ctgaagatgg atttggcccc
     2161 acaaggaggg tttgacaacc agggaaacac accatttggc aagggcgtta tgaagccaac
     2221 aaccatcaat aggctactca tacaagctgt ggctctcacc atggagaggc aggatgagtt
     2281 ccggctccag gggaagatgt atgacttcga cgatgatcga gtgtcagcat tcaccaccat
     2341 ggcacgcgac aacgggttgg gcatcttgag catggcgggc ttaggcaaga agctgcgcgg
     2401 cgtcacatcg atggaaggtc tgaagaacgc cttgaagggg cacaaaattg gcatgtgcac
     2461 aattaagtgg caggccaagg tgtattcact agaatcagat ggtaacaatg ttaacatcag
     2521 agaggagaaa aacgttctaa cccaacaaca acagtcagtg tgcgctgctt ccatcgcact
     2581 cacccgcctg cgggctgcgc gtgcggtggc gtacgcatca tgcatccagt cagcaataac
     2641 ctccatacta caaattgctg cctcggctct tgtggtcaac agggctgtga aaagaatgtt
     2701 tggcacacgc actgctgctc tgtccttaga gggccccccc aaggaacaca agtgcagagt
     2761 ccaccaggct aaagccgcag ggaaagggcc cattggccat gatgatatgg ttgaaaagta
     2821 tggactgtgt gagactgagg aggacgaaga agtggtccac actgagatgc catctgccac
     2881 catagaaggc aagaacaaag gaaagaacaa gaaggggcgt ggccggaaga acaactacaa
     2941 tgccttttcc cgtagaggac tcaatgatga agagtacgaa gagtacaaga aaatacggga
     3001 agagaagggt ggcaactaca gcatccagga gtacctagag gataggcaaa ggtacgaaga
     3061 ggagcttgca gaggtccagg caggtggaga cggaggaatc ggtgaaaccg aaatggaaat
     3121 ccgacataga gtattctaca agtctaagag caagaaacac caccaggaag agcggcgcca
     3181 actggggtta gtcacaggtt ccgacattcg aaaaaggaaa ccaatcgatt ggaccccccc
     3241 taagtcagca tgggcagatg atgatcgtga agtggactac aatgagagga tcaactttga
     3301 agcgcccccc accttgtgga gccgggtcac aaagtttgga tctggatggg gcttctgggt
     3361 tagccccaca gtcttcataa ccacaacaca tgttatacca accagtgcaa aggaattctt
     3421 tggcgagccc cttgccagta tagccatcca cagggccgga gaattcaccc tcttcaggtt
     3481 ttctaagaag atcaggcccg atctcacggg catgatcctt gaggaaggtt gtccagaagg
     3541 cacggtgtgc tcagtgctaa taaagaggga ttccggcgag ctactaccac tagctgtaag
     3601 gatgggcgcc atagcatcaa tgcgcataca gggtcgcctt gtccatgggc agtctggtat
     3661 gttgctcact ggggctaatg ctaagggcat ggaccttggg accatcccag gggattgtgg
     3721 agctccttat gtctacaaga gagcaaatga ctgggtggtc tgtggtgtac acgctgccgc
     3781 tactaaatca ggcaacacag tagtgtgcgc cgtccaagcc agtgaggggg aaaccacgct
     3841 tgaaggaggt gacaaaggcc actatgccgg acatgagata gtcaaacatg gatgtggacc
     3901 agccctatca accaaaacaa aattctggaa atcatctcct gaaccactgc cccctggggt
     3961 ctacgagccc gcataccttg gtggccggga tccaagggtg agtggtggtc cttcgctcca
     4021 acaggtgtta cgggatcagt tgaagccatt tgctgagcca cgggggcgta tgccagaacc
     4081 aggtctcttg gaggccgcag ttgagactgt gacctcatca ctagagcagg ttatggacac
     4141 cccagtgccg tggagttaca gcgatgcgtg ccaatccctc gataaaacca ccagttctgg
     4201 tttcccccac cataagagga agaatgatga ctggaatggc accgccttca ttagggaact
     4261 aggagaacaa gcagcgcacg ctaacaacat gtatgaacaa gccaaaagca tgaagcctat
     4321 gtacacggca gcgcttaagg atgaattagt gaagccagaa aaagtgtacc aaaaagtgaa
     4381 aaagcgcttg ctctgggggg cggacctagg aacagtgatc cgggctgcac gagcttttgg
     4441 cccattttgt gatgccataa agtctcacac aatcaaacta cctatcaaag ttgggatgaa
     4501 ttcaattgag gacgggccac taatctatgc agaacattca aagtataagt accactttga
     4561 tgcagattat acagcttggg attcgacaca aaacaggcaa attatgacag agtcattctc
     4621 catcatgtgc cgtttgactg cttctccaga attggcctca gtggtagcgc aagacctgct
     4681 tgcaccctca gaaatggacg ttggtgacta cgtcattagg gtgaaggaag gccttccatc
     4741 tggttttcca tgtacatcac aggtcaatag cataaatcac tggttaataa ccttatgtgc
     4801 cctctctgaa gtgactggtc tatcaccaga tgttattcag tccatgtcat acttttcttt
     4861 ctatggtgat gatgaaatag tttccactga catagagttt gacccagcaa agttgacaca
     4921 agtcctcaaa gaatacggcc tcaaacctac ccgacctgat aagagcgaag gtccaataat
     4981 tgtaagaaag aatgtggatg gcctagtctt tttacgccgt accatttccc gtgatgccgc
     5041 ggggttccag gggcgactag accgggcatc cattgaaagg cagatctatt ggaccagagg
     5101 gcccaaccac tcagaccctt ttgaaacctt agtgccccac cagcaaagaa aagtccaatt
     5161 gatatcactg ctgggtgagg cctcattgca tggtgaaaag ttctacagaa aaatttctag
     5221 caaagtcatc caagagatca agacaggggg ccttgaaatg tacgtaccag ggtggcaagc
     5281 catgttccgc tggatgcggt tccatgatct tggtctgtgg acaggagatc gcaatctcct
     5341 acccgaattt gtaaatgatg atggcgtcta aggacgcccc aacatcccct gatggcgcca
     5401 gtggcgctgg ccagctggta ccggaggcta atacagctga gcaaatttca atggaccctg
     5461 ttgcgggtgc ttcaacagca gtcgcaacag ctgggcaagt taatatgatt gacccatgga
     5521 ttttcaataa cttcgtccag gcaccccaag gagaatttac tatttcccct aataataccc
     5581 ccggtgacat tttgtttgat ttacaattag gaccccacct taatccattt ctagcccacc
     5641 tctcacaaat gtataatggt tgggtcggca atatgcgtgt acgtatattg ttggcaggga
     5701 atgcttttac agctggtaag ataatcattt gctgtgtccc ccctggcttt gatgctagaa
     5761 tacttacaat agcccaagca actctctttc cacacttgat tgctgatgtt aggactcttg
     5821 agcctgtgga gctccctctg gaggacgtgc gcaacgttct ctatcacaac agcagccagc
     5881 cgcagccaac aatgcggttg gtagctatgt tgtacactcc cctccgcact ggtggtggct
     5941 ccggaggtac tgatgccttt gtggttgcgg gcagggtgct cacgtgcccc gcccctgatt
     6001 tcagctttct gtttctcgtc cccccctccg ttgagcagaa gactagggtt tttagtgtcc
     6061 ccaacatacc cctgaaagac ctttcaaatt ctcgtgtccc tgtgcctata cagggcatgt
     6121 tcatgtcccc agatgtcaat cagtcagtcc agttccagaa cgggcgctgc cagatcgatg
     6181 gtcaactcca gggcactacc cctgtctcgc tcagtcaact ttgcaagatt aggggtaaga
     6241 cttcaagcaa tgccagggta ctcaacttaa gtgaggtgga tggcacaccc tttatccctc
     6301 ttgagtctcc agcaccagtt ggttttcccg acttaggagg ttgtgactgg catgtaaact
     6361 tcactttcca ggctcagaat caggacccat ctcaaagtgt gacctttgca actaatgatg
     6421 ctagctttgt tccctactta ggcagcattt ctcctcacaa tgggggggat tttcatgcag
     6481 gtgacatcat aggcagcctt ggctggattt cagccccgtc tgacaataca caacttaatg
     6541 tctggacaat accaaagtat gggtctagtc tcccagatgt cactcacctt gcacctgctg
     6601 tgttcccccc aggctttggg gaggtgattc tgtacttcta ctctacattc ccaggttctg
     6661 gacaacctag tcagcttcaa gtgccatgcc tgttgcctca ggagttcatc acccacttct
     6721 gcaatgaaca ggctcccatc gctggggaag ctgctctcct ccattacgtg gaccctgaca
     6781 cgggacggaa cctgggggaa ttcaaactct atcctgatgg gttcatgacc tgtgtcccca
     6841 atagtgttag tagtggccct caaacccttc ctatcaatgg agtctttgtc tttgtttcat
     6901 gggtatccag attttatcaa ctcaagcctg tgggaacggc ctcagcggct agaaggcttg
     6961 gactgcggcg catataatgg cccaagctgt catcggtgcc atagccgcat ctgccgctgg
     7021 tagtatactg ggggcaggca tacaggctgg tgctgaggct ggtctccagg ctcaacggta
     7081 ccagcaagac ttgcaattgc agcaaaactc tttcaagcat gatagggaaa tgttaggtta
     7141 tcaggttcag gctagtaatg ctcttttagc taagaatctt aacactagat atgctcttct
     7201 gcaggcaggg ggtctgtcta gtgctgatgc tgctcgggca gtggctggtg ctcctgtcac
     7261 ccgtatagtg gactggaatg gcacgcggat tgcagcgcca acctcgagca ccactacact
     7321 tagatctggt ggttttatgg ctgtccctat accattgtct tcaaagacca agcaaccagt
     7381 gatgtctggg caggataatc caaattatgc tgcttcttct atctctagaa ctgcttcatg
     7441 ggtacaatct caaaattcta tgagatctgt ttctcctttt cacagtgatg ctctgagaac
     7501 cgtgtgggtc acaccaccag gttcgtcatc aacttcatct gtgcaatcta gtttttatgg
     7561 tgtttttaat acagataggt tgcctctgtt cgcaaacaga aggtgatatt tttgtaatag
     7621 gatgccggtg ggcaccatat tcagatttaa ttttaattgg atattttaat tacaatttgg
     7681 cttaattggt gtt
//