Typing tool

Complete norovirus genomes

AB044366  GII.12
 GII.P12

Length: 7,518 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6692
ORF3: 6692..7471
LOCUS       AB044366                7518 bp    RNA     linear   VRL 18-JUL-2018
DEFINITION  Norwalk-like virus genes for RNA polymerase, VP1 protein, VP2
            protein, complete cds,
            strain:Hu/Norovirus/hiroshima/1999/JP(9912-02F).
ACCESSION   AB044366
VERSION     AB044366.2
KEYWORDS    .
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Hansman,G.S., Doan,L.T., Kguyen,T.A., Okitsu,S., Katayama,K.,
            Ogawa,S., Natori,K., Takeda,N., Kato,Y., Nishio,O., Noda,M. and
            Ushijima,H.
  TITLE     Detection of norovirus and sapovirus infection among children with
            gastroenteritis in Ho Chi Minh City, Vietnam
  JOURNAL   Arch. Virol. 149 (9), 1673-1688 (2004)
   PUBMED   15593412
  REMARK    DOI:10.1007/s00705-004-0345-4
REFERENCE   2  (bases 1 to 7518)
  AUTHORS   Abe,K., Noda,M., Ikeda,Y., Kamimura,M., Fujii,A., Yamaoka,K. and
            Ogino,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2000) Contact:Katsuhiko Abe Hiroshima city
            Institute of public health, Division of Biological Science;
            Nishi-ku Shoko-center 4-1-2, Hiroshima city, Hiroshima 733-8650,
            Japan
COMMENT     On May 19, 2004 this sequence version replaced AB044366.1.
FEATURES             Location/Qualifiers
     source          1..7518
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /strain="Hu/Norovirus/hiroshima/1999/JP(9912-02F)"
                     /db_xref="taxon:95340"
     CDS             5..5104
                     /note="N-terminal, helicase, VPg, 3Cpro, RdRp;
                     orf1"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="BAA96531.2"
                     /translation="MKMASNDASAAAAANSNNDTAKSSSDGMLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEPVVSYSVKDGVSGLPELTTVRQPG
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KREEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRTM
                     PELRQALKNISIKSCQIVYGGCTYMLESDGKGDVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCIQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETASKDGC
                     PKPKDDDEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPNLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6692
                     /note="VP1 (capsid) protein;
                     orf2"
                     /codon_start=1
                     /product="VP1 protein"
                     /protein_id="BAD20208.1"
                     /translation="MKMASSDAAPSNDGAAGLVPEANNETMALEPVAGASIAAPLTGQ
                     NNIIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATNSAKFTPKLGAIQIGTWEEDDVHINQPTKFTPVGLFED
                     GGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFFRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQSDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6692..7471
                     /note="VP1 (capsid) protein;
                     orf3"
                     /codon_start=1
                     /product="VP2 protein"
                     /protein_id="BAD20209.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQVQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRYWAPGATKTTTFSGGFTNVSHARTVDLTKKTSATPAPAPVSRPSSVASTVSTRSTL
                     ISGSSNPSSLARSSSSVSSQPTSSSSRTSEWVRSQNRALEPYMRGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRRRGESQV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggaatgct ttctagtatg gctgtcacat ttaaacgagc
      121 cctcggggca cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acccacccca gaactggtca aaaagatccc tcctcctcca cccaacgggg aggatgaacc
      241 agtggtttct tacagcgtca aagatggcgt ttccggcttg cctgagctta ccactgtcag
      301 gcagccgggt gaaaccaaca cggcgttcag tgttccccca ctcaatcaaa gggagaatag
      361 ggacgccaag gagccactaa ctggaacaat cctggaaatg tgggacgggg agatctacca
      421 ttacggcctg tatgtggaac gaggtcttgt acttggtgtg cacaaaccac cggctgccat
      481 cagcctcgcc aaggttgaac taacaccact ctctctgttt tggagaccag tgtatacacc
      541 acagtatctc atctctccgg acactctcag gagactgcac ggagagtcgt ttccctacac
      601 agcctttgat aacaactgct atgccttctg ttgttgggtc ctggacctaa acgactcgtg
      661 gttgtgcagg agaatgatcc agaggacaac tggtttcttc aggccctacc aagactggaa
      721 taggaaaccc cttcccacca tggatgactc caagttgaag aaggtagcta acatattctt
      781 gtgcgcgcta tcttcgctat tcactaggcc catcaaagac ataataggaa agttgaggcc
      841 tctcaacatc cttaacatct tggcttcatg tgattggact tttgcaggca tagtggaatc
      901 tttgattctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgcccct ttactaggtg actacgagct gcaggggccc gaggaccttg cagtggaact
     1021 cgttccaata gtgatggggg ggattggttt ggtgctaggg ttcaccaaag agaagatcgg
     1081 gaaaatgttg tcatctgctg catccacctt aagagcttgt aaagaccttg gtgcatacgg
     1141 actggaaatc ttaaaattgg tcatgaagtg gttcttccca aagagagagg aagcaaatga
     1201 gctggctatg gtgaggtcca tcgaggatgc ggtgttggac ctcgaggcaa ttgaaaacaa
     1261 ccacatgact gccctcctca aagacaaaga cagcctggca acctatatga gaactcttga
     1321 cctcgaggag gagaaagcca gaaagctttc gaccaagtct gcttcacctg atatcgtggg
     1381 cacaatcaac gctctcctgg cgagaatcgc cgctgcacgc tccctggtgc atcgggcgaa
     1441 agaggagctc tccagcagac caagacctgt tgttgtgatg atatcaggta agccagggat
     1501 agggaaaacc caccttgcca gggaattggc caagaaaatc gcagcttctc tcacagggga
     1561 ccagcgtgtg ggtcttatcc cgcgcaatgg tgttgatcac tgggacgcat ataagggaga
     1621 aagagtcgtt ctatgggacg actatggaat gagtaacccc atccacgacg ccctcaggtt
     1681 acaagaactt gctgacacct gccccctcac gctaaattgt gataggattg agaataaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaac ctggccaacc cagcaccact
     1801 ggactatgtc aattttgaag catgctcgag gcgtatcgac ttcctcgtgt atgcagatgc
     1861 ccctgaagtc gagaaggcga aacgtgattt cccaggtcaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gacttctcgc acataaaact gatgctggct ccgcagggtg gcttcgacaa
     1981 gaacggaaac accccacatg ggaaaggcgt catgaaaacc ctcactactg gttccctcat
     2041 cgctcgagca tcagggctac tccatgagag gttagatgag tacgagttac agggcccaac
     2101 ccccactacc ttcaactttg accgcaacaa ggtgcttgcg ttcagacagc ttgctgctga
     2161 aaacaagtac gggttgatgg acacaatgag agtcggaaaa cagctcaagg atgtcaggac
     2221 catgccagag ctcagacaag cactcaagaa catctcaatc aagagttgcc agatagtgta
     2281 tggtggctgc acctatatgc ttgagtctga tggcaagggt gatgtgaaag ttgacagagt
     2341 tcagaacgcc actgtgcaga ccaacaatga actggccggc gccctacacc atcttaggtg
     2401 tgccaggatt agatattatg tcaagtgcat tcaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtca ccacgcgcat tgtcaagcgc atgaacatac aagacctttg
     2521 gtccaagcca caggtggaag atacagagga gactgctagc aaggatgggt gcccaaaacc
     2581 caaggatgat gacgagttcg ttgtttcatc cgacgacatc aaaaccgagg gcaagaaagg
     2641 aaagaacaag tctggccgtg gtaagaagca cacagcattc tcaagcaaag gcctcagtga
     2701 tgaggagtac gatgagtaca aaagaatcag agaagaaaga aacggcaagt actctataga
     2761 ggaatacctt caggacagag ataagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaagaag aagaggccaa gatccgacaa aggattttta ggccaacaag
     2881 gaagcaacgc aaagaggaga gggcctctct cggcttggtc acaggttctg aaatcaggaa
     2941 gaggaaccca gacgacttca agcctaaagg aaagctgtgg gctgatgacg acaggagtgt
     3001 tgactacaat gagagactca attttgaagc cccaccaagc atttggtcga ggatagtcaa
     3061 ctttggttca ggttggggtt tttgggtttc ccccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agttctttgg ggtttccatc aagcaaattc agatacacaa
     3181 atcgggtgaa ttctgtcgct tgaggtttcc aaaaccaatc agaactgatg tgacaggcat
     3241 gatcctagaa gaaggtgcgc ccgaagggac cgtggtcaca ttactcatca agagaccaac
     3301 tggagaactc atgcccttgg cagccagaat gggaacccat gcaaccatga agatacaagg
     3361 gcgcactgtt gggggtcaaa tgggcatgct cctaacagga tctaacgcca agagtatgga
     3421 cctgggcacc acaccaggtg actgtggctg tccctacatt tacaagagag ggaatgacta
     3481 catagtcatt ggagtccaca cggctgctgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggagc gagggggaag ccacacttga aggcggtgac aacaagggaa cctactgcgg
     3601 tgcaccaatc ttaggtccag ggagtgcccc aaagctcagc accaagacta agttttggag
     3661 atcatccaca gcaccactcc cacctggtac ctatgaacca gcctatcttg gcggcaagga
     3721 ccccagagtc aagggtggcc cctcattgca acaagttatg agggaccagc tgaaaccatt
     3781 cactgagccc aggggcaaac caccaaaacc aagtgtgtta gaggctgcca agaaaaccat
     3841 catcaatgtt cttgaacaaa caattgaccc acctcaaaaa tggtcattcg cgcaggcatg
     3901 cgcatccctc gacaagacca cttccagcgg ccacccgcac cacatgcgga agaacgactg
     3961 ctggaacggg gagtccttca caggcaaatt ggcagaccag gcttccaagg ctaacctgat
     4021 gttcgaagag ggaaagaaca tgaccccagt ctacacaggt gcgcttaagg acgagctggt
     4081 caagactgac aaaatttatg gcaagatcaa aaagaggctt ctctggggct cggatctggc
     4141 aaccatgatc cggtgtgctc gagcgtttgg aggcctgatg gaggaactca aagcacattg
     4201 tgtcacacta cccgtcagag taggtatgaa tatgaatgag gatggcccta tcatctttga
     4261 gaggcactcc agatataagt atcattatga tgctgattac tcccggtggg actcaacaca
     4321 acaaagagcc gtgttagcag cagccttaga aatcatggtt aagttctccc cagaaccgaa
     4381 tctggcccaa aaggttgcag aagaccttct ctctcccagc gtgatggacg taggtgactt
     4441 caaaatatca atcaatgagg gcctcccctc cggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ccctctgtgc gctttctgag gttacaaacc tgtcccctga
     4561 cattatccag gctaattccc tcttttcctt ctacggtgat gatgaaattg tgagcacaga
     4621 cataaaattg gacccagaga agttgacagc aaaacttaag gaatacgggt tgaaaccgac
     4681 ccgccctgac aagactgagg gaccccttgt tatctctgag gacctggatg gcctaacctt
     4741 cctgcggagg actgtgaccc gcgacccagc tggctggttt ggaaagctgg aacagagctc
     4801 aatacttagg caaatgtatt ggactagggg ccctaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtctttg ctgggcgagg ctgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gctggtcatt gcagagctga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgaggt tttcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccgc tccatctaat gatggtgcag ccggtcttgt accagaggct aacaatgaga
     5161 ccatggcact tgaaccggtg gctggggctt caatagccgc cccactcacc ggccaaaaca
     5221 atattataga cccctggatt agattaaatt ttgtgcaggc tcccaatgga gagttcacgg
     5281 tttcaccccg caactcgccc ggggaagtcc tattaaattt ggaattaggc cccgaactaa
     5341 atccatacct agcacacctc tctagaatgt ataatggtta tgcgggtggg gttgaggtgc
     5401 aagtactact ggctgggaat gcgttcacag ctggaaaact ggtgtttgcc gcagttcccc
     5461 ctcattttcc attagaaaat ataagccctg gccagataac tatgttccct catgtaatta
     5521 ttgatgttag gactttagaa ccagttttgt tgccccttcc tgatgttagg aataatttct
     5581 ttcattataa tcagcagaat gaaccgagga tgagacttgt agcaatgctt tatactcctc
     5641 ttagatctaa tggttctggt gatgatgtat tcactgtctc ctgcagggtg cttacccgac
     5701 cttcccctga ttttgatttt aattatttgg tcccccctac tgttgaatct aaaaccaaac
     5761 ccttcacact ccctatcttg actatagggg agttaaccaa ctccaggttc cctgtaccta
     5821 tagatgagct ctacaccagt cccaatgaga gtctggtggt gcaaccccag aacgggagat
     5881 gcgcactaga tggggagctg cagggcacga ctcagctcct ccccacggcg atctgctcgt
     5941 tcaggggccg gatcaatcag aaggtgagtg gggaaaacca tgtttggaat atgcaggtca
     6001 ccaacatcaa cgggacccct tttgatccaa cagaggatgt cccggctcct ctaggcactc
     6061 cagatttctc tggcaagctc tttggtgtac taagccagag agaccatgat aatgcctgca
     6121 ggagtcatga tgcagtaatt gcaaccaact ctgccaaatt taccccaaaa ttgggcgcta
     6181 tacaaattgg cacatgggaa gaagacgatg tgcacatcaa ccaacctact aagtttactc
     6241 cagttggctt gtttgaagat ggaggtttca accagtggac actccccaat tattctggag
     6301 ccttaacact taatatggga ttggcccctc ctgtggcccc caccttccct ggtgaacaaa
     6361 ttcttttctt tagatcccac attcctctta aaggaggtgt ggcggaccca gttattgatt
     6421 gtctcttgcc tcaagaatgg atccaacatc tttaccaaga gtcggccccc tcacaatcag
     6481 atgtagcact gattaggttt acaaatccag acacaggacg tgttctattt gaagcaaaat
     6541 tacacaggag tggttacatc acagtggcca atactggtag cagaccgatt gtggtaccag
     6601 ctaatggtta cttcaggttt gactcttggg ttaatcaatt ctattctctt gcccccatgg
     6661 gaactggaaa tgggcgcaga agggtgcagt aatggctgga gcttttatag cggggcttgc
     6721 tggtgacata gtcaccaatg gcattggctc acttgtgaac gctggggcta atgcaataaa
     6781 tcaaaaagta gactttgaaa acaacaagca actacagcag gcttctttca accatgataa
     6841 agagatgctg caagctcaag tccaggccac caaacagctg caggctgata tgattgcaat
     6901 cagacaaggg gtgttgaccg cgggcggctt ctcccccact gatgcagcaa gaggggcagt
     6961 taatgcacct atgactcagg ttttagactg gaatgggacc agatattggg cccccggagc
     7021 cacgaaaacc actactttct ccggtggatt caccaatgtt tctcatgcca gaactgtcga
     7081 cctgaccaag aagacatcag ccacaccagc tcctgcgcct gtttccagac ctagctctgt
     7141 cgcctctaca gtctccaccc gctcaacctt gattagcggg tcttccaatc cttcttcttt
     7201 agctaggagt tcttctagtg tttcttctca acccacctcc tcctcttctc ggaccagtga
     7261 gtgggtgcgc agccaaaaca gggcactgga gccttacatg aggggagcgc tacgcacagc
     7321 ctatgtgacg cctccctcta gtagagcttc tagtaatggc acagtctcaa ccgtgccaaa
     7381 agaggttttg gactcctgga catctgcatt taacacccac agacaaccgc tattcgctca
     7441 tctccgtcgg agaggggagt cacaagttta gtgaaaagat aatctttatt ttctttcctt
     7501 tgaagatttt tgtctttt
//