Typing tool

Complete norovirus genomes

AB042808  GI.4
 GI.P4

Length: 7,697 | 3 CDS

ORF1: 5..5362
ORF2: 5346..6980
ORF3: 6980..7606
LOCUS       AB042808                7697 bp    RNA     linear   VRL 06-JAN-2001
DEFINITION  Chiba virus genomic RNA, complete genome.
ACCESSION   AB042808
VERSION     AB042808.1
KEYWORDS    .
SOURCE      Chiba virus
  ORGANISM  Chiba virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Someya,Y., Takeda,N. and Miyamura,T.
  TITLE     Complete nucleotide sequence of the chiba virus genome and
            functional expression of the 3C-like protease in Escherichia coli
  JOURNAL   Virology 278 (2), 490-500 (2000)
   PUBMED   11118371
REFERENCE   2  (bases 1 to 7697)
  AUTHORS   Someya,Y., Takeda,N. and Miyamura,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2000) Yuichi Someya, National Institute of
            Infectious Diseases, Department of Virology II; Toyama 1-23-1,
            Shinjuku, Tokyo 162-8640, Japan (E-mail:someya@nih.go.jp,
            Tel:81-3-5285-1111(ex.2523), Fax:81-3-5285-1161)
FEATURES             Location/Qualifiers
     source          1..7697
                     /organism="Chiba virus"
                     /mol_type="genomic RNA"
                     /strain="Hu/NLV/Chiba 407/1987/JP"
                     /db_xref="taxon:99565"
     gene            5..5362
                     /gene="ORF1"
     CDS             5..5362
                     /gene="ORF1"
                     /function="nonstructural"
                     /note="A polyprotein includes RNA helicase, VPg, protease,
                     and RNA polymerase"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAB18266.1"
                     /translation="MMMASKDVVAATAASAENTSDNSDSIKNRFFTRLKNLGSNNKPI
                     KIENTHMALNLISRGSSPVPQDKPPKDQRDKPPRNVAETQQAMGWIDPPVDQNLPTWE
                     ELSQTEKQEILKNNSNWFDAGGLAPASIPSGYVKNTEQQPPDHQVKWSANNGVDLGVD
                     SLTTVPGPAWNLCPMPPIDQRNNGPAREPLIGDMIEFYEGHIYHYAIYIGQGKTVGVH
                     SPQAAFSIARITIHPIAAWWRVCYIPTPDQRLNYDQLKELENEPWPYAAVTNNCYEFC
                     CRILNLQDTWLERRLVTSGRFNHPAQDWSRDTPDFQQDSKLEIVRDAVLAAINGLVSK
                     PFKDLLNKLKPLNVLNLLSNCDWTFMGVVETIILLMELFGIFWNPPDVSSFIASLLPD
                     MHLQGPEDLAKDLIPLVLGGVGLAIGFTKDKVTKVMKSAVEGLRAATQLGQYGLEIFA
                     VLKKYFFGGDQTEKTLKDIETAVIDMEVISTTAVTQLVRDKQAARTYMNILDAEEEKA
                     RKLSVRHADPHVVSTTNALISRISLARSALAKAQAEMTNRVKPVVIMMCGPPGIGKTK
                     AAEYLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMSKIADDCNKLQA
                     IADTAPLTLNCDRIEKKGLQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVYCTA
                     PDVEQTRRTNPGDTGALKDCFKSDFSHLKMELAPQGGFDNQGNTPFGKGTMRPTTLNR
                     LLIQAVALTMERQDEFQMQGQVYDFDADRVSAFTSLARANGLGLISMASLGKKLRGVD
                     SVHGLKNALSGYTITPCSIKWQARVYDIESDGTNVQIKENTSAQTQRQQSIDTAALAL
                     TRLKAARAAAYAACIQGAITTILQMAGSAIVINRAVKRMFGAHSSTIALEGPPREHRC
                     RAHLAKAAGGGPIGHDDVIDKYGLCETEEEGTSEEMNVELPTATSEGKNKGKTKKGRG
                     RRANYNAFSRRGLSDEEYEEYKKIREEKNGNYSIQEYLEDRQRYEEELAEVQAGGDGG
                     IGETEMEIRHKIFYKSKKGRQNERRQLGLVTGSDIRKRKPIDWTPPKNDWADDNREVD
                     YNEKLSFEAPPTLWSRVVRFGSGWGFWVSPTVFITTTHVIPTGVREFFGEPIESIAIH
                     RAGEFTQFRFSRKVRPDLTGMVLEEGCPEGVVCSILIKRDSGELLPLAVRMGAIASMK
                     IQGRLVHGQSGMLLTGANAKGMDLGTLPGDCGAPYVYKRNNDWVVCGVHAAATKSGNT
                     VVCAVQAGEGETTLEGGDKGHYAGHEIIKHSKGPALSTKTKFWRSTPEPLPPGVYEPA
                     YLGGRDPRVKGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSMLEQTMDTPT
                     PWSFSDACQSLDKTTSSGHPYHKRKNDDWNGTSFVGELGEQAAHANNMFELGKSMKPL
                     YTAALKDELVKPEKVYQKIKKRLLWGADLSTVIRAARAFGPFCDAIKPHVIKLPIKVG
                     MNSIEDGPMIYAEHAKYKNHFDADYSAWDSTQNRQIMTESFAIMCRLTASPELASVVA
                     KDLLAPSEMDVGDYIIRVKEGLPSGFPCTSQVNSINHWLITLCAMSEVTGLSPDVIQS
                     QSYFSFYGDDEIVSTDIDFDPARLTQVLKEYGLRPTRPDKSEGPIILRRQVDGLVFLR
                     RTISKDAAGFQGRLDRGSIERQLWWTRGPNHDDPSETLIPHPQRKVQLISLLGEASLH
                     GEKFYRKISSKVIQEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVNDDG
                     V"
     gene            5346..6980
                     /gene="ORF2"
     CDS             5346..6980
                     /gene="ORF2"
                     /function="structural"
                     /note="ORF2 encodes a capsid protein which makes
                     nucleocapsid."
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="BAB18267.1"
                     /translation="MMMASKDATPSADGATGAGQLVPEVNTADPIPIDPVAGSSTALA
                     TAGQVNLIDPWIINNFVQAPQGEFTISPNNTPGDVLFDLQLGPHLNPFLSHLSQMYNG
                     WVGNMRVRVVLAGNAFTAGKVIICCVPPGFQSRTLSIAQATLFPHVIADVRTLDPVEV
                     PLEDVRNVLYHNNDTQPTMRLLCMLYTPLRTGGASGGTDSFVVAGRVLTCPGPDFNFL
                     FLVPPTVEQKTRPFTVPNIPLKYLSNSRIPNPIEGMSLSPDQTQNVQFQNGRCTIDGQ
                     PLGTTPVSVSQLCKFRGRITSGQRVLNLTELDGSPFMAFAAPAPAGFPDLGSCDWHIE
                     MSKIPNSSTQNNPIVTNSVKPNSQQFVPHLSSITLDENVSSGGDYIGTIQWTSPPSDS
                     GGANTNFWKIPDYGSSLAEASQLAPAVYPPGFNEVIVYFMASIPGPNQSGSPNLVPCL
                     LPQEYITHFISEQAPIQGEAALLHYVDPDTNRNLGEFKLYPGGYLTCVPNSSSTGPQQ
                     LPLDGVFVFASWVSRFYQLKPVGTAGPARGRLGVRR"
     gene            6980..7606
                     /gene="ORF3"
     CDS             6980..7606
                     /gene="ORF3"
                     /function="unknown"
                     /note="ORF3 encodes a protein rich in basic amino acids,
                     whose function is unknown"
                     /codon_start=1
                     /product="basic protein"
                     /protein_id="BAB18268.1"
                     /translation="MAQAIIGAIAASAAGSALGAGIQAGAEAALQAQRYQQDLTLQQN
                     SFNHDKEMLGYQMEMSNKLLAKNLNTRYSLLQAGGLSSSDAARAVAGAPVTRLVDWGG
                     VRVAAPQSSATTLRSGNFMAVPLPAQPKQKPLASEGYSNPAYDPVQRTASWVQSQNSS
                     RSWSPYHRQALQTVWVTPPGSTSSSSVSTAPRGYFNTDRLPLFANLRR"
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcagctact gctgctagtg ctgaaaacac
       61 tagtgacaat agtgattcta taaagaaccg cttcttcaca agattgaaga atttaggttc
      121 taacaataaa cctataaaaa ttgagaacac ccacatggcc ctcaacttaa ttagtagggg
      181 gtcatctcca gttccacaag ataagccccc taaagatcag cgggacaaac ccccaaggaa
      241 tgtggccgaa actcaacaag caatgggatg gattgacccc cccgtggatc agaatctacc
      301 aacctgggag gaattgagcc aaacagagaa acaagagata ctcaaaaaca actcaaattg
      361 gttcgatgct ggtggattgg caccagctag catcccttcc ggttatgtga agaacacaga
      421 gcagcaaccc cctgaccacc aagtcaagtg gagtgccaat aacggggttg atctgggggt
      481 ggacagttta accactgtgc caggcccagc atggaatcta tgccccatgc caccaattga
      541 tcagcgtaac aatggtccag caagagagcc acttattggt gacatgatag agttctatga
      601 gggtcacatc taccattatg caatatatat tggccaagga aaaactgttg gggtccactc
      661 acctcaagcg gccttttcaa tagccagaat aactatacac cccattgctg cttggtggag
      721 ggtttgttac ataccaacgc ctgatcagag gttaaactat gaccaactca aagagcttga
      781 gaatgagcca tggccatatg ctgcagtcac caataactgc tatgagttct gctgcaggat
      841 tcttaacctg caggatactt ggttagaacg ccgtttggtc acatctggtc gttttaacca
      901 cccagcacaa gactggtcca gggacacacc tgacttccaa caagatagca aactagaaat
      961 agttagggac gccgtgcttg ctgctatcaa tggcctggtg tcaaagccct ttaaagatct
     1021 cctaaataaa cttaagccac tcaacgtgct caacctactc tccaattgtg attggacatt
     1081 tatgggagtg gtggagacga taatattact catggaattg tttgggattt tctggaaccc
     1141 ccctgatgtg tccagcttta tagcctcact actacctgac atgcacttgc aaggaccaga
     1201 agatctggct aaagacttaa taccattggt gttggggggt gtagggcttg caattggatt
     1261 tactaaggac aaagtcacaa aggttatgaa aagtgctgtt gaagggctga gggcagccac
     1321 acaactgggt caatatggcc tagaaatatt tgcagtttta aagaaatatt tctttggtgg
     1381 agatcaaaca gagaagactt taaaggatat tgaaacagcc gtgatcgaca tggaggtcat
     1441 ctcaacaact gctgtcacgc aactggttag ggacaaacag gctgcccgaa cttacatgaa
     1501 catcttggat gccgaagaag aaaaggcaag aaagctttca gttagacatg cagaccccca
     1561 tgtcgtgtcc acgactaatg ctttgatctc acgtatttca ctggctcgct ccgcacttgc
     1621 taaagcacaa gctgagatga ccaatagggt taaaccagta gtaataatga tgtgtggtcc
     1681 cccaggcata ggcaagacaa aggcagctga gtaccttgct aagagattgg ccaatgagat
     1741 acggcctgga ggaaaagttg gcctcgtgcc acgagaggct gtggatcatt gggatggata
     1801 tcatggtgaa gaggttatgc tatgggatga ttatggtatg tcaaagatag ccgatgactg
     1861 taataagttg caggccatag ccgacacagc cccactcacc ttgaattgtg atcggattga
     1921 gaagaaagga ttacagttcg tctctgatgc catagtgata acaacaaatg ccccaggccc
     1981 agctccagtc gactttgtca atcttggccc agtgtgtcgg cgggtagatt tcttggttta
     2041 ctgcaccgcg cccgatgttg aacaaacacg tcgcactaac cctggagaca ctggagccct
     2101 taaggattgt ttcaaaagtg acttctctca tctaaaaatg gagttagccc cacagggcgg
     2161 atttgataat caaggaaata ctccatttgg taaagggacc atgcggccca ccacattaaa
     2221 ccgtctcctc atacaggctg tggcactaac catggagcgc caggatgagt tccagatgca
     2281 aggccaagtg tatgattttg atgctgacag ggtttccgcc tttactagtt tagcaagagc
     2341 caatggtctg ggcctcatta gcatggcctc tctaggaaag aaattgaggg gcgtggactc
     2401 ggttcatggc ctcaagaatg cattatcagg ctataccata accccttgta gtataaaatg
     2461 gcaggctaga gtgtatgaca ttgaatcaga tggtactaat gtacaaataa aggaaaacac
     2521 ctcagcccaa actcaacgcc agcagtcaat tgacacagct gccctagcac tcactaggct
     2581 taaagcagca cgggcagcag cgtatgcagc ttgcatacaa ggcgcaataa caactatcct
     2641 gcagatggct ggatcggcca tcgttataaa tcgtgctgtg aaaaggatgt ttggggcaca
     2701 ctcaagcacc atagcccttg aagggccgcc aagagaacat cggtgtaggg ctcatttggc
     2761 caaggctgca ggtggtggac caataggcca tgatgatgtc atcgataagt atggcctatg
     2821 tgagactgag gaggaaggca ccagcgagga gatgaatgtg gagcttccca ccgccacttc
     2881 tgagggtaaa aacaaaggaa agaccaagaa aggaaggggc agaagagcca actacaatgc
     2941 tttttcaagg cggggtctga gcgatgaaga atacgaggag tacaagaaga tcagggaaga
     3001 aaagaatggt aattacagta tccaggagta tcttgaagac agacaacgct atgaagaaga
     3061 gctcgcagaa gtgcaagctg gtggagatgg aggcattggt gagacagaaa tggagattcg
     3121 acacaagatc ttctataaat ccaaaaaggg tcgccaaaat gagcgccgcc aattaggact
     3181 agtcactggc agtgacatca gaaagagaaa accaattgat tggacccccc ccaaaaatga
     3241 ttgggcagat gataataggg aagtggatta caatgaaaaa ctcagttttg aagccccacc
     3301 aaccctctgg agtcgagtcg tgagatttgg ctctgggtgg ggcttttggg tgagcccgac
     3361 tgtttttatc accaccaccc atgttatacc aactggggtg cgtgaattct ttggggagcc
     3421 cattgaatct atagcaatcc atcgtgctgg tgaatttaca caattcaggt tttcacgcaa
     3481 agtccgcccg gatctgactg gaatggtgtt ggaggaaggc tgtcctgagg gtgtcgtgtg
     3541 ttctattctt atcaagcgtg actctggtga gctgctaccc cttgctgtcc gaatgggcgc
     3601 tatagcgtcc atgaagatcc agggaaggct agtgcatggt caatctggga tgctgctcac
     3661 tggggctaac gctaagggga tggatttagg taccctacca ggtgattgtg gtgcccctta
     3721 tgtgtacaaa agaaacaatg actgggtggt ttgtggtgta catgcagctg ccacgaagtc
     3781 aggtaacact gtagtatgtg ctgttcaggc tggggaaggt gaaaccaccc tagagggtgg
     3841 tgataaaggc cactatgctg gccatgagat aatcaagcat agcaagggcc cagctttatc
     3901 aaccaaaacc aagttttgga gatcaacccc tgagccatta ccaccaggtg tttatgaacc
     3961 agcatacctt gggggtcgtg acccaagggt aaaaggtgga ccttccctac aacaagtcct
     4021 gcgtgatcag ttgaaaccat ttgccgagcc acgaggccgg atgccagagc ctggtttact
     4081 tgaggcagcc gttgaaactg tcacatccat gcttgaacaa acaatggata caccaacccc
     4141 ctggtctttc tctgatgcat gtcaatcact tgacaagacc acaagttcgg gacacccata
     4201 ccataaaagg aaaaatgatg attggaatgg aacttcattt gttggggagc ttggagaaca
     4261 ggcggcacat gccaacaaca tgtttgaatt gggcaagtct atgaagccac tttacaccgc
     4321 ggccctaaag gatgaattag tcaagcctga gaaagtttat caaaagatta agaagaggct
     4381 tctctggggt gctgatctct caacagttat aagggctgct agagcctttg gaccattttg
     4441 tgatgctata aagccccatg tcattaaact ccctattaaa gttggtatga actccataga
     4501 agatggtcca atgatttatg cagaacatgc aaagtataag aatcattttg atgcagatta
     4561 ctcggcctgg gattccacac aaaatagaca gatcatgact gagtcctttg caatcatgtg
     4621 ccgccttacg gcatcaccag aattggcctc tgttgtagcc aaagatctac ttgcgccttc
     4681 agagatggat gttggggact acatcatccg tgtaaaagaa ggtttgccat caggatttcc
     4741 ttgcacttca caggtgaaca gtataaacca ttggctaatc acattgtgtg ctatgtctga
     4801 agtcacaggc ctgtcacctg atgtcataca atctcagtct tacttttctt tctatggtga
     4861 tgatgagata gtctcaacag atattgattt tgaccccgcc cgcctcactc aagtgcttaa
     4921 ggaatatgga ttgagaccca cccggccaga caaatcagaa ggacccatta tacttagaag
     4981 acaggtagat ggtctcgttt tcttaaggag gacaatctca aaagatgctg caggctttca
     5041 gggaaggcta gatagaggct caatagaaag gcagctctgg tggactcgag gccctaacca
     5101 tgatgatcct agtgagactt taatcccaca ccctcagagg aaagttcagc ttatatccct
     5161 ccttggcgag gcttcccttc atggtgagaa gttttatagg aaaatctcca gtaaagtcat
     5221 acaggagata aagactggtg gtttggaaat gtatgtgcca ggctggcagg ctatgttccg
     5281 ctggatgcgc ttccatgatc tcggattgtg gacaggagat cgcaatctct tgcccgaatt
     5341 cgtaaatgat gatggcgtct aaggacgcta caccaagcgc agatggcgcc actggcgccg
     5401 gccagctggt accggaggtt aatacagctg accccatacc tattgaccct gtggctggct
     5461 cctctacagc ccttgccaca gcaggccagg ttaatttgat tgatccctgg ataatcaata
     5521 attttgtgca agccccccag ggcgagttca caatatcccc aaataatacc cccggtgatg
     5581 tgctttttga tttgcaatta ggaccccatt taaatccttt cctttcccac ctttctcaga
     5641 tgtataatgg ttgggtgggc aacatgcgag tgcgtgttgt cttggctggt aatgctttca
     5701 cggctgggaa ggttataatt tgttgtgtcc cccctggttt ccaatctcgc accctttcta
     5761 tagcccaggc tactttattt ccccatgtta ttgctgatgt taggaccctt gaccctgtag
     5821 aagtgcccct tgaagatgtt aggaatgtgt tgtatcataa taatgacacc caacccacca
     5881 tgcgcctcct ttgcatgttg tacactcctc tccgcaccgg gggagcgtct ggtgggactg
     5941 attcttttgt ggtggctggg cgtgtactca cttgtccggg ccctgacttt aacttcttat
     6001 tcctagtccc tcccacagtc gagcaaaaga cccgcccttt tactgtgcct aatatccctt
     6061 tgaagtacct gtctaattcc aggatcccaa atcctattga aggtatgtca ttgtcacctg
     6121 accagaccca aaatgttcaa ttccagaatg gtaggtgtac aattgacggt caaccccttg
     6181 ggaccacacc tgtctcagtt agtcagttat gtaagtttag gggtaggatt acatctggac
     6241 agagagtgct caacttgaca gagttggatg gttcaccttt tatggccttt gccgcccccg
     6301 cccctgcggg ctttccagat cttgggtcct gtgattggca tattgaaatg agtaaaatcc
     6361 caaattccag cacccagaac aacccaatag tgaccaattc tgtcaaaccc aatagtcaac
     6421 agtttgtccc acacttgtca agtatcaccc ttgatgaaaa tgtttccagt ggaggtgact
     6481 atattggcac tatacaatgg acctcacctc cttctgattc tggcggggcc aatacaaatt
     6541 tttggaaaat ccctgactat gggtccagcc tagcagaagc ttcacaactg gcccccgctg
     6601 tctatccacc tggtttcaat gaggtgattg tgtattttat ggcatctata cctggtccca
     6661 atcagtctgg gtctcctaat ttagtgccat gcctgctccc ccaggaatat ataacacact
     6721 ttattagtga gcaggccccc atccagggtg aggctgcctt actccactat gtagacccag
     6781 acaccaatcg caatttgggt gagttcaaat tatatcctgg tggttattta acctgtgttc
     6841 ctaatagttc tagtactgga cctcaacaac ttcctcttga tggtgtattt gtctttgctt
     6901 cttgggtttc tagattttat caattaaagc ctgtgggaac agccggaccg gctagaggta
     6961 ggcttggtgt ccgtagataa tggcccaagc cattatagga gccattgccg cctccgcagc
     7021 cggtagcgcc cttggtgctg gcatccaggc tggtgctgaa gctgcgttgc aggcacagag
     7081 atatcaacaa gatctgactt tgcagcaaaa ttcttttaat catgataagg aaatgttagg
     7141 ttatcaaatg gaaatgtcca acaagttgct agctaaaaat cttaacaccc gctattctct
     7201 tctccaggcg ggtggcctct catcctctga tgcggctagg gctgtagccg gggcccccgt
     7261 cactaggttg gtcgactggg ggggagtgcg tgttgcggca ccccaatcat ctgccaccac
     7321 attgagatct ggtaatttta tggctgtgcc actcccagct cagccaaaac agaagcccct
     7381 tgccagtgaa ggttattcta accctgctta tgaccctgtg caacgcacag cctcttgggt
     7441 tcaatctcag aactccagcc ggtcttggtc tccataccat aggcaagccc ttcagactgt
     7501 gtgggtgacc ccccctggtt ctacctcttc ttcttctgtt tctactgccc ctcgagggta
     7561 tttcaataca gatagattgc ctctattcgc aaacttgagg cgttaatgtt gtaataagat
     7621 tagtgagcat cctattcaat ttttggcttt atataatttg gttataattg gcttttaatt
     7681 ttgatttggt tgatgtt
//