Typing tool

Complete norovirus genomes

AB039781  GII.3
 GII.P3

Length: 7,541 | 3 CDS

ORF1: 5..5113
ORF2: 5094..6740
ORF3: 6740..7504
LOCUS       AB039781                7541 bp    RNA     linear   VRL 05-SEP-2002
DEFINITION  Norwalk-like virus genomic RNA, complete genome, isolate:Saitama
            U18.
ACCESSION   AB039781
VERSION     AB039781.1
KEYWORDS    polyprotein; hypothetical protein; capsid; N-terminal, helicase,
            VPg, 3Cpro, RdRp.
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Kojima,S., Kageyama,T., Oka,T.,
            Hoshino,F., Fukushi,S., Shinohara,M., Uchida,K., Suzuki,Y.,
            Gojobori,T. and Takeda,N.
  TITLE     Phylogenetic analysis of the complete genome of 18 Norwalk-like
            viruses
  JOURNAL   Virology 299 (2), 225-239 (2002)
   PUBMED   12202225
REFERENCE   2  (bases 1 to 7541)
  AUTHORS   Katayama,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2000) Kazuhiko Katayama, National Institute of
            Infectious Diseases, Department of Virology II; 4-7-1 Gakuen,
            Musashi-murayama, Tokyo 208-0011, Japan (E-mail:katayama@nih.go.jp,
            Tel:81-42-561-0771, Fax:81-42-561-4729)
FEATURES             Location/Qualifiers
     source          1..7541
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /isolate="Saitama U18"
                     /db_xref="taxon:95340"
     CDS             5..5113
                     /note="N-terminal, helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAC11833.1"
                     /translation="MKMASNDASVAVAGKNNNNDKEKSSGDSLFSNMTVSFKKALGAR
                     PKQPPPGEIKQTQKPPRPPTPELVKRIPPPPPNGEDEPKVVYRVGEGVSGLPDLTTVA
                     QPDAQNTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVERGHILGVHKPPA
                     AISLAKIELTPLSLYWRVVYTPQYLIAPDTLKGLSGESFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIQRTTGFFRPYQDWNRKPLPTMDEPKIKKAANAILCAISSLFTRPIKDI
                     IGKLKPMNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLKACKDLGAYGLEILKLVMKW
                     FFPKKEEANELALVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKIASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHYRPDFTHIKLQLAPQGGFDKNGNTPHGKGVVKSLTLGSLI
                     ARASGLLHERMDEFELQGPNLPTFNFDRNKIAAFRQLAAENKYGMVDTLRVGNQLKSV
                     KTMDELKQAIKNITIKKCQIVYNGCTYTMESDGRGKVSVDKVQSATVQTNNELSGALH
                     HLRSARIRYYVKCFQEAVYSLLQIAGAAFVTSRIVRRMNISSLWSKPPVEENDESEDK
                     EGCPKPRDEDDLTIDSKDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDRYYEELAIAKATEENFCEEEEIKIRQRIFRPTKKQRKEERTTL
                     GLVTGSEIRKRNPDDFKPKGKLWADDNRSVDYNERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITEAFGVPMSQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVASILIKRTTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYVYKRGNDFVVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPSVLESAKKTIINVLEQVIDPPQKWSYAQACASLDKTTSSGYPHHVRKN
                     DYWNGESFTGKLADQASKANLMYEEGKHMPPVYTAALKDELVKTDKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDELKANCITLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5094..6740
                     /codon_start=1
                     /product="capsid"
                     /protein_id="BAC11834.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKVIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPINLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKLFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGAT
                     QLLPSQICAFRGTLTRSTSRASDQTDTPTPRLFNHRWHIQLDNLNGTPYDPAEDIPAP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTSGRFTPKLGSLEITTESDDLDTNQS
                     TKFTPVGIGVDNEAEFQQWSLPNYSGQFTHNMNLAPAVALNFPGEQLLFFRSQLPSSG
                     GRSNGVLDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     CDS             6740..7504
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BAC11835.1"
                     /translation="MAGAFIAGLAGDMFTNTVGSLVNAGADAINQKVDFENNKYLQNA
                     SFNHDKEMLSAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDRSE
                     TRYWAPNAAFTTSMSGGFTSQVVHRTTPDLKTSQAPKFTPSSGSSVRSSSTQLTNLSS
                     HSSGSSRSSGSTVVSSLPSSSRTRDWVNQQNLNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgttgccgtt gctggcaaaa acaacaacaa
       61 cgacaaggaa aaatcttcag gtgacagctt gttttctaac atgactgtct cctttaagaa
      121 agccctcggg gcgcggccta aacaaccgcc cccgggagaa ataaaacaaa cacaaaaacc
      181 accaagacca ccaacaccgg aattggtgaa aagaataccc ccaccaccac ccaacggcga
      241 ggatgaacca aaggtggtat atagggtggg agaaggtgtg tccgggctgc ccgacttaac
      301 aaccgtggcg caacctgacg cacaaaacac agcttatagt gtacccccac ttagccaaag
      361 agaggtcggc gaagctaaag aaccgctacc tggatccatt ctggaaatgt gggatggtga
      421 gatctaccac tatgggctgt acgttgagcg agggcacata cttggggtgc ataaaccacc
      481 tgctgcaata agtctcgcca aaattgaact gacaccactg tctctctact ggagagtggt
      541 ttacactccc cagtacttga tagccccgga cactctgaag ggcttgagtg gagaatcatt
      601 cccatacaca gcctttgaca acaactgtta cgccttctgt tgttgggtct tagatctcaa
      661 tgactcttgg cttagcagga gaatgattca aaggacaacc ggcttcttca ggccgtacca
      721 agattggaac agaaaacccc tgccaaccat ggatgagcca aaaattaaga aggccgcgaa
      781 tgctattctg tgtgctatct catcactctt cactagaccc attaaggaca ttattggaaa
      841 gctcaaacca atgaacatcc tcaatatatt ggcaacttgt gactggactt ttgcaggcat
      901 agtggagtct cttattcttc ttgctgaact ttttggggtg ttctggacac ccccagacgt
      961 gtctgcgatg attgccccct tactcggtga ctacgagatg cagggcccag aagacctggc
     1021 cgtggaactt gtacccgtgg taatgggagg gataggtttg gtgttgggat tcaccaagga
     1081 gaagatcggc aagatgcttt catcagctgc atccacgctt aaggcctgca aagatctagg
     1141 agcctatgga ttggagatac tcaaattggt catgaagtgg ttcttcccta agaaggaaga
     1201 ggctaacgag ttagccttgg taagggccat cgaggatgca gtcctggatt tagaggcaat
     1261 agaaaacaac cacatgacca ctctcctcaa ggacaaagac agtctggcta catacatgag
     1321 gactcttgac ctggaggaag agaaagcaag aaaactgtcc accaaatccg catcacccga
     1381 cattgtgggc acaataaatg cattattggc aaggattgca gccgctaggt cactagtcca
     1441 caaggctaag gaggagctct caagtagaca gaggcctgtc gtcgtgatga tatctggcag
     1501 accaggcata gggaagaccc atctcgccag agagctagcc aagaagattg catcaaccct
     1561 gtcgggcgac caaaggattg gactggtgcc cagaaacggt gtagaccact gggacgccta
     1621 caagggggag agagtggtac tatgggatga ctatggcatg agcaacccca tacaggatgc
     1681 actgaggctt caagagttgg ctgatacctg tcccctaact ctaaactgtg acagaattga
     1741 aaacaaggga aaagtgtttg acagtgatgc cataatcata acaaccaacc ttgcaaatcc
     1801 agcaccgctg gactatgtca actttgaggc ttgctccaga cgcatagact ttttagtgta
     1861 tgcagatgca cctgacattg agaaagccaa gcgtgacttc cccggtcaac cagatatgtg
     1921 gaaagatcac tacagaccag actttacaca catcaaactt cagctagcac cacagggagg
     1981 ttttgacaag aatggcaaca ccccacatgg taaaggtgta gtgaagtctc tgacgcttgg
     2041 gtcattgatc gccagggctt ccggtttgct tcacgagaga atggatgagt tcgagctcca
     2101 aggccctaat ctaccaacct tcaattttga ccgcaacaag atcgctgcct tcaggcaatt
     2161 ggcagctgaa aacaaatatg gtatggtgga cacactgagg gtcggtaatc aactgaagag
     2221 tgtcaagacc atggatgagc tcaaacaggc tataaagaat atcaccatca agaagtgcca
     2281 aatagtgtac aacgggtgta cctacacaat ggagtctgat gggagaggca aggtctcagt
     2341 tgacaaggtg caaagcgcaa cagtccaaac taacaatgag ctttcaggag cgttgcacca
     2401 cttaagatct gcaagaataa ggtattatgt taaatgcttc caggaagctg tctattcttt
     2461 attacaaatt gctggtgcgg cttttgtcac ctcacgcatt gtgaggcgca tgaacatctc
     2521 gagcctctgg tcgaaaccgc ctgttgaaga gaatgatgaa tctgaagaca aagaagggtg
     2581 ccccaagccc cgagatgaag atgacctcac tatcgattcc aaggacatca aagtggaagg
     2641 aaagaaaggc aagaacaagt ccggccgggg taagaaacac acagctttct catctaaggg
     2701 cctcagtgat gaagagtacg atgagtacaa gagaatcagg gaagaaagga atggaaaata
     2761 ttcaatagag gagtacctcc aagacaggga cagatactat gaagagctag ccattgccaa
     2821 ggccactgaa gagaacttct gtgaggagga agagatcaaa atccgtcaga gaattttccg
     2881 ccccaccaaa aagcagcgga aagaggaaag aaccacactt gggctcgtca cagggtcgga
     2941 gatcagaaag aggaacccag atgacttcaa gccaaaaggg aaactgtggg ctgatgataa
     3001 caggagtgtg gactacaatg agaggataga ttttgaagcg ccccctagcg tttggtcaag
     3061 gatagtcaac tttggcacag gctggggatt ctgggtttct ccaagtctct ttataacctc
     3121 gacacacgtg ataccaaaag gaatcacgga ggcgtttggg gtgcccatga gccaaatcca
     3181 aattcacaaa tcaggggaat tctgccgctt acggttccca aaaccaatca ggccagacgt
     3241 gagtgggatg attttggaag agggtgctcc tgaaggaact gttgcatcca tcctcatcaa
     3301 aagaacaaca ggggagttga tgccccttgc agccagaatg ggaacccacg ccacaatgaa
     3361 aatccaggga agaacggtgg gtggtcagat gggcatgtta ctcacaggtt caaatgccaa
     3421 aagcatggac ctaggcacaa caccaggtga ctgtgggtgc ccctacgtgt acaagagggg
     3481 caatgacttt gtggtcattg gcgtgcacac tgcagcagca cgtggaggaa acacagtcat
     3541 atgtgccacg caaggaagcg aaggtgaagc cactcttgag ggaggtgacg acaagggcac
     3601 ctattgtgga gcccccattt taggacctgg taatgcacca aagttgagca caaaaacaaa
     3661 attctggaga tcttccaacg caccgctccc gccaggcacc tatgaaccag catacctagg
     3721 tgggaaagat ccacgtgtga agggcggtcc gtctctgcaa caggtcatga gagaccaact
     3781 taaacctttc acagagccca gagggaaacc accaaacccg agtgtcctag aatcagcaaa
     3841 gaagaccatc atcaatgttc tagagcaggt tattgacccc ccccagaagt ggtcctatgc
     3901 ccaagcttgt gcatcccttg acaaaacaac ttccagtgga tacccgcatc acgttcggaa
     3961 gaatgattac tggaatggtg agtccttcac aggaaaactt gcagaccagg cttcaaaagc
     4021 aaatctcatg tacgaagaag gcaaacacat gccaccggtt tacaccgcag cgctcaagga
     4081 tgagctggtg aaaactgaca aaatctatgg caaaattaag aaaaggctcc tgtggggttc
     4141 tgacctctct accatgattc ggtgcgccag agcatttggt ggcctcatgg atgagctcaa
     4201 agcaaattgt atcacacttc ctgtcagagt tggcatgaac atgaatgaag atggtcccat
     4261 aatatttgag aaacattcca gatacagata ccactatgat gcagactact ctcgctggga
     4321 ctccacgcag cagcgggcag tgttggcagc agcacttgaa atcatggtga ggttctctgc
     4381 tgaaccacag ctagcacaaa tagtagctga agacctgcta gcaccaagtg tggttgatgt
     4441 gggtgacttc aagatcacca ttaatgaggg cctaccttct ggtgtgcctt gcacctcaca
     4501 gtggaactcc attgcccact ggttgcttac tttgtgtgcc ctttctgaag tgacaggact
     4561 aggccccgac atcatacaag ctaattccat gtactctttc tatggtgatg atgagattgt
     4621 aagcactgac ataaaattgg acccagagaa actgactgca aaacttaaag agtacggcct
     4681 caaacccacc cggcccgaca agaccgaggg gccgctggtg atcagtgaag acctgaatgg
     4741 tttaacgttc ctccgccgaa cagtcacccg tgacccagca ggttggtttg gaaagctgga
     4801 gcaaagttcc atcctcaggc agctatactg gacaagggga cctaaccatg aagaccccag
     4861 tgaaaccatg ataccacatg cgcagagacc cgtgcagctc atggcactac tgggagaatc
     4921 ctccctgcat ggaccctcat tctacagcaa ggtcagcaag ctggttatat ctgaacttaa
     4981 ggagggagga atggattttt atgtgcccag acaagagtca atgtttaggt ggatgaggtt
     5041 ctcagatctg agcacatggg agggcgatcg caatctggct cccagttttg tgaatgaaga
     5101 tggcgtcgaa tgacgctgct ccatctaatg atggtgccgc cggcctcgtc ccagagatca
     5161 acaatgaggc aatggcgcta gagccagtgg cgggcgcagc gatagcagcg cccctcactg
     5221 gccagcaaaa tataattgat ccctggatta tgaataattt tgtgcaagca cctggtggtg
     5281 agtttacagt gtcacctagg aattcccctg gtgaagtgct tcttaatttg gaattaggtc
     5341 cagaaataaa cccctatttg gctcatcttg ctagaatgta caatggttat gcaggtggat
     5401 ttgaagtgca agtggtccta gctggaaatg cgtttacggc aggaaaggtt atctttgcag
     5461 ctataccccc taatttccct attgacaatc tgagcgcggc acagatcaca atgtgcccgc
     5521 acgtgattgt ggatgtcagg cagttggaac caatcaatct cccgatgcct gatgtccgca
     5581 acaatttctt tcattataat caaggttctg attcaagatt acgtttgatt gcaatgttgt
     5641 atacacctct tagggcaaat aattctggag atgatgtttt cactgtgtct tgtagggtgt
     5701 taactaggcc cagccctgat ttctcgttca attttcttgt cccacccact gtggaatcaa
     5761 agacaaagct ttttaccctc cccattttaa ccatctctga aatgtccaat tccaggtttc
     5821 cagttccaat tgactcttta cacaccagcc caactgagaa tatagttgtc cagtgccaaa
     5881 atgggcgcgt cactcttgac ggtgagttaa tgggcgccac ccaactctta ccgagccaaa
     5941 tatgtgcttt caggggcaca ctcactagat caacaagcag ggccagcgac caaaccgaca
     6001 caccaacccc taggctattc aaccatcgtt ggcacataca attggacaat ctaaatggaa
     6061 ctccctacga ccctgcagag gacataccag ctcctttggg cacaccagac ttccggggta
     6121 aggtctttgg cgtggccagc cagagaaacc ccgacagcac aacaagggca catgaagcaa
     6181 aagtggacac aacatctggc cgcttcaccc caaaattggg ctctttagaa ataaccactg
     6241 agtctgatga ccttgacaca aaccagtcaa caaaattcac cccagttggc atcggggttg
     6301 acaatgaggc agaatttcag caatggtcct tacccaacta ttctggtcag tttactcata
     6361 acatgaactt agccccagct gtcgccctca attttcctgg tgaacagcta cttttcttcc
     6421 gatcacagct gccatcctct ggtgggcggt ctaacggggt tctagactgc ttggtccccc
     6481 aggaatgggt tcaacacttt taccaagaat cagcccccgc ccaaacgcag gtggccctgg
     6541 ttaggtatgt caaccctgac actggcagag tgctatttga ggctaagcta cacaaattgg
     6601 gttttatgac tatagcaaag aatggtgact ccccaataac tgtccctcca aatggatact
     6661 ttagatttga atcttgggtt aacccctttt atacacttgc ccccatggga actggaaacg
     6721 ggcgtagaag gattcaataa tggctggagc ttttatagca ggattggctg gtgacatgtt
     6781 cacaaatact gtggggtctt tggttaatgc aggggccgat gctattaatc aaaaagtcga
     6841 ttttgaaaat aataaatatt tgcaaaatgc ttcttttaat catgataagg agatgttaag
     6901 tgcacaaatt gaggcaacaa agaggctgca ggctgacatg attgcaatca aacaaggggt
     6961 cttgaccgct ggcggctttt cccccactga tgcagcacgt ggagcaatta atgctccaat
     7021 gacaaaagtt ttggatcgga gtgaaacaag gtactgggca ccaaacgccg ccttcacaac
     7081 ttcaatgtca ggtggcttca caagccaagt tgtgcacaga accacaccag atcttaaaac
     7141 gagccaggcc cccaaattca cacccagcag tgggtcttca gtgagatcaa gctcaaccca
     7201 actcaccaac ttgagctcac actcatccgg gtcgtcccga tccagtgggt ctacggttgt
     7261 cagctcgctg ccgtcctcca gtaggactag ggactgggtc aaccaacaaa atctcaattt
     7321 ggaaccacac atgcctgggt ctctcaggac agcttttgtc actccaccat ctagcacagc
     7381 ctctagttca ggcacagtct caaccgtgcc caaaaatgtt ttggactcct ggacatctgc
     7441 gtttaacacg cgcagacagc cgctgtttgc acaccttcgt agaagggggg agtcaaatgt
     7501 ttagtgaaaa gattattcct aaatttgatt tagaatcctt t
//