Typing tool

Complete norovirus genomes

AB039780  GII.8
 GII.P8

Length: 7,524 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6698
ORF3: 6698..7471
LOCUS       AB039780                7524 bp    RNA     linear   VRL 05-SEP-2002
DEFINITION  Norwalk-like virus genomic RNA, complete genome, isolate:Saitama
            U25.
ACCESSION   AB039780
VERSION     AB039780.1
KEYWORDS    polyprotein; hypothetical protein; capsid; N-terminal, helicase,
            VPg, 3Cpro, RdRp.
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Kojima,S., Kageyama,T., Oka,T.,
            Hoshino,F., Fukushi,S., Shinohara,M., Uchida,K., Suzuki,Y.,
            Gojobori,T. and Takeda,N.
  TITLE     Phylogenetic analysis of the complete genome of 18 Norwalk-like
            viruses
  JOURNAL   Virology 299 (2), 225-239 (2002)
   PUBMED   12202225
REFERENCE   2  (bases 1 to 7524)
  AUTHORS   Katayama,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2000) Kazuhiko Katayama, National Institute of
            Infectious Diseases, Department of Virology II; 4-7-1 Gakuen,
            Musashi-murayama, Tokyo 208-0011, Japan (E-mail:katayama@nih.go.jp,
            Tel:81-42-561-0771, Fax:81-42-561-4729)
FEATURES             Location/Qualifiers
     source          1..7524
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /isolate="Saitama U25"
                     /db_xref="taxon:95340"
     CDS             5..5104
                     /note="N-terminal, helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAC11830.1"
                     /translation="MKMASNDATAAAGNFNIANNSENTPPPVKEEASVLSNVKVGFKK
                     ILGAVPKQPKPPEVKAKDQPRVLVNGKTLEVPPPPPNGEDVIYYNSKDDTVHGLPNLT
                     TVSCEGENLPYTVPPLSEREHRAAPEPLPGTILEMWDGEFYHYAIYVSGGKAIGVHKP
                     PAAISLATIELTPISLYWRPVYVPNYLVHPDTLKSLAGEKFPYTAFSNNCYNFCCWVL
                     DLKDSWLNRRSITRTTGFFKPYQSWNKKPLPTVDDGKIKKVANAVLCALGSLFSKPIK
                     DLIGKLKPLNFLNLLASCDWTFSGVVETVILAAELFGVFWTPPDVSNFIASLIGDFEL
                     QGPEDLAVELVPIIMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVM
                     KWFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTALLKDRDSLLTYMKTLDLEEEKA
                     RKLSTKSSSPDIVGTINAILARIAAARSLLHRAKEEMYSRPRPVVVMISGRPGVGKTH
                     MARHLAKSVAGTMSGDQRIGLIPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALALQE
                     LADTCPVTLNCDRIENKGKMFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYADA
                     PTIEKAKKDFPGQPDMWKEHFKADFSHLKLTLAPQGGFDKNGNTPHGKGTMKTLTQGS
                     LTARVAGLVHERKDEFQLQGGELQVYNFDTNKVSAFRKLAADNNYGFLETMRVGSSLK
                     DVKTVEDLKCALKSVSFKECEIIYRNVKYRISSDGCGKVSIEKLADNNSQTTREIITA
                     VTRLQQARARYYISCFQDLVYTLLQVAGASFVINRIVKKFNWERWVKAPETDEPTPSN
                     DKPDTEEEWEIAPKDVDSEGKKGKNKKGRGRKHTAFSSKGLSDEEYDEFKRLREEKQG
                     RYTIEEYLQDRDRYYEELAVARATEENFCEEEEIKIRQRIFRPTKKQRKEERGVLGLV
                     TGADIRKRRPDDFQPKGKLWADDSRSVDYNEKIEFEAPPSVWSRIVPLGTGWGFWVSS
                     NLLITTTHVLPKGIKELFGVDIKQVQVHKSGEFCRFRFPKPVRPDVSGLILEEGAPEG
                     TVCSVLIKRSTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGD
                     CGCPYIYKRGNDIVVAGVHTAAARGGNTVICATQGPDGEAVLEGGEDHGTYCGAPILA
                     PGKAPKLSTKTKFWRSSPDSLPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEEAKKTVMNVLEQTIEPAKPWTYSQACASLDKTTSSGSPHHVRKNEHW
                     NGESFTGPLADQASKANLMYEEGKHMNPMYTAALKDELVKTDKIYKKIKKRLLWGSDL
                     GTMLRCARAFGGLLDSMKESCISLPCRVGMNINEDGPLIFEKHSKYTYHYDADYSRWD
                     STQQRAVLSAAMEVMVKFSAEPELAQVVAEDLLAPSRLDVGDFVISVQEGLPSGVPCT
                     SQWNSIAHWILTLSAMSEVSGLSPEVVQANSCFSFYGDDEIVSTDINLDPEKLTRKLR
                     EYGLVPTRPDKTEGPLVITQDLNGLTFLRRTIVRDPAGWFGKLDRDSILRQLYWTRGP
                     NHENPFESMIPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQE
                     AMFRWMRFSDLSTWEGDRNLAPENVNEDGVE"
     CDS             5085..6698
                     /codon_start=1
                     /product="capsid"
                     /protein_id="BAC11831.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINHEVMAIEPVAGASLAAPVVGQ
                     LNIIDPWIRNNFVQAPAGEFTVSPRNAPGEFLLDLELGPELNPYLAHLARMYNGHAGG
                     MEVQIVLAGNAFTAGKILFAVIPPGFPYENLSPAQLTMCPHVVVDVRQLEPILLPMPD
                     IRNTFFHYNQSNGPKLRLVAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFEFNFLVPP
                     SVESKTKAFTLPILKISEMTNSRFPIPVDQMYTSRNENIVVQPQNGRVTLDGELQGTT
                     TLQPVSICGFRGTLQTRLADQPNYTYQVHLENLDGSPVDPTDEVPAPLGTPDFQAQLF
                     GVISQRSSDNATRAHEARVNTNDPTFAPQIAQVRFKSPSNDFFDNEPIKFTPVGISVD
                     SQNSYNQWLLPRYGGHLTNNTHLAPSVSPMFPGEQILFFRSFMPGASGHTDGAIDCLL
                     PQEWVAHFYQEAATAQTDVALIRFVNPDTGRVLFEGKLHKQGFITISNSGDHPIVMPA
                     NGYFRFEAWVNQFYSLAPVGTGSGRRRIQ"
     CDS             6698..7471
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BAC11832.1"
                     /translation="MAGAFLAGLAGDVVTSGIGSLINAGANAVNQKVEYDFNRQLQEA
                     SFKHDKEMLNAQINATTKLQRDMIAIKQGVLTAGGFSPTDAARGSINAPTTKILDWNG
                     SRYWAPGSMRTTAYSGNFTSQGVKQPTPIVKSVKPQVQQSPAPSSVYSVGSVRSQSTQ
                     STQLTGSGTVSRAPTPSTTTTLSRTSEWVRSQNDRLSPFMGGALQTAFVTPPSSKASS
                     SSGTVSTVPREILDSWTPAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgctgccgct ggcaacttta acattgccaa
       61 caacagtgaa aacactcccc ctcccgttaa ggaagaggcg agtgtcctat ccaacgtaaa
      121 agttggattc aagaaaatat tgggggctgt gccgaagcag cccaagccac cagaagtgaa
      181 agccaaagat cagcccaggg tgctggtcaa tggcaagacc ctggaggtgc cacccccacc
      241 tccaaatggt gaagatgtga tttactataa tagcaaagat gacactgtgc atggcctgcc
      301 aaatttgaca acagtcagct gtgaaggtga aaacctcccg tacacggtcc ctcctctcag
      361 cgagagggag cacagggcag caccagaacc actacctggt accatactag agatgtggga
      421 tggtgagttc taccattatg cgatatacgt ctctggtggc aaggccatag gggtgcacaa
      481 acccccagct gcaatcagcc ttgccaccat cgagctcaca cctatatcgc tttactggag
      541 gcctgtttat gtccccaact acttagtcca ccctgacaca ctcaagagct tagctggtga
      601 aaagtttcca tacactgcat ttagcaacaa ctgttataat ttctgttgct gggttcttga
      661 tttgaaagat tcgtggctta accgcagatc aataactaga acaactggtt tcttcaagcc
      721 ttatcagtcc tggaacaaga agccactccc gacggtggac gatggaaaaa tcaagaaagt
      781 tgccaatgct gtcctatgtg ctcttggttc actattctca aaacctatta aagacttgat
      841 tgggaaactg aaaccactga acttcttgaa tctcctcgct tcgtgcgact ggactttctc
      901 cggggtggtt gagaccgtca tactagctgc tgagttattt ggagtgtttt ggaccccccc
      961 cgacgtgtcg aacttcatcg cgtcactcat cggagacttt gaattgcagg gcccagagga
     1021 tttagctgtg gaattggtac cgatcatcat gggcggcatc gggatggtgt tgggattcac
     1081 tgccgagaag attggccgaa tgctgtcatc agcagcatcg acccttaggg catgcaaaga
     1141 cctaggcaac tacgcccttg acatacttaa actggttatg aagtggttct tcccaaagaa
     1201 agaggaaaag gcagagatgg agaccctgag ggccatagag gatgctgtct tagatatgga
     1261 ggcgattgga aacaaccacc tcaccgccct gctgaaagac agggacagcc tcctgaccta
     1321 catgaagacc ctagacctcg aagaagagaa ggcgagaaaa ttgtccacaa aatcatcttc
     1381 gcctgacatc gtgggcacca ttaatgctat actagccaga atcgccgcgg ctaggtctct
     1441 cctgcacagg gctaaagaag agatgtacag cagacctagg cctgtcgtgg tgatgatatc
     1501 aggaagacca ggagttggta aaacccacat ggccaggcac ctcgccaaaa gtgtagcagg
     1561 caccatgagc ggtgatcaga gaataggcct catccctcgc aatggggttg atcactggga
     1621 tgcctacagg ggagaacgag tcgtcttgtg ggacgactat ggtatgggta acccagtaaa
     1681 agatgccctt gcattgcaag aactagcaga cacttgtcca gtcaccctta attgtgacag
     1741 aatagaaaat aaagggaaaa tgtttgacag cgaggtaata attataacaa ccaatttggc
     1801 caaccccgcc ccgcttgact atgtcaactt tgaggcttgt tcccgcagaa ttgacttcct
     1861 cgtctacgca gatgccccga ccattgagaa ggcgaagaag gactttcccg ggcaaccaga
     1921 catgtggaag gagcacttta aagcagactt ctctcatctc aagctcacac tggccccgca
     1981 aggtggtttt gacaagaacg gcaacacacc acatgggaag ggaactatga aaaccttaac
     2041 ccagggttcc ctcacagcaa gagtggccgg acttgtgcat gaaaggaaag atgagtttca
     2101 actgcaaggt ggagagctac aggtctacaa ttttgataca aataaggtgt cagctttcag
     2161 gaagcttgct gcagacaata actatggatt cctggagaca atgagagtcg gttcctcact
     2221 caaggatgtc aagacagtgg aggacctcaa atgtgctctt aagagtgtca gcttcaaaga
     2281 atgtgaaata atctacagaa atgtcaagta ccgcatatca tcagacggtt gcggcaaggt
     2341 cagcatagag aaactggcag ataacaactc ccaaacaacc agagaaatca tcacggccgt
     2401 cactagacta caacaggctc gtgctaggta ttacatcagc tgcttccaag acctagtcta
     2461 cacactcttg caagttgccg gggcctcatt tgttatcaat agaatagtca agaagttcaa
     2521 ctgggaacga tgggtcaagg ctccagagac agatgaaccc acaccaagta acgataagcc
     2581 cgacactgaa gaagaatggg agatcgcccc caaagatgtg gactctgaag gtaaaaaggg
     2641 gaagaacaag aaaggcaggg gacgcaaaca cactgcattc tccagcaaag ggcttagtga
     2701 tgaggaatat gacgaattca agagactgag ggaagagaaa cagggccgct acacaataga
     2761 agagtacctc caggatagag atcggtacta cgaagagctg gcggtggccc gggccactga
     2821 agagaacttc tgtgaagagg aagagataaa gatcaggcaa aggatattcc gccccaccaa
     2881 aaagcagagg aaggaggaac gtggggttct gggactcgtc acaggagcag acatcaggaa
     2941 acgaagaccc gacgacttcc aacctaaagg gaaactgtgg gcagatgatt ctaggagcgt
     3001 cgactacaat gagaagatcg agtttgaagc tcctcctagc gtctggtcaa gaatcgtccc
     3061 gcttgggact ggctggggat tttgggtctc atccaatttg ctaattacca ctacacatgt
     3121 gttgcccaag ggcatcaaag agctttttgg agtggacatc aaacaagtcc aagtccataa
     3181 atcaggtgaa ttttgcagat tcaggttccc aaagccagtg aggcccgatg tctctgggtt
     3241 gatattagaa gaaggggccc ctgaaggaac agtgtgctct gttctcatca agaggtcaac
     3301 aggagagatg atcccccttg cagttaggat gggtacccac gcctctatga agatccaggg
     3361 gcgtactgtt ggcggccaga tgggcatgct gctcactgga gccaacgcta agaatatgga
     3421 tttaggtacc ggtcccgggg attgtggttg cccgtacata tacaagaggg gcaatgacat
     3481 tgtggtggct ggtgtccaca cagcagcagc acgcggaggc aacacggtca tctgtgcaac
     3541 ccaagggcct gatggtgagg cggtgttaga agggggagag gaccacggca cctactgtgg
     3601 agccccaata ctggcccctg gtaaagcgcc gaagcttagc acaaagacca aattctggcg
     3661 ctcgtccccc gactctcttc cccctgggac gtatgaacca gcttaccttg ggggtaagga
     3721 cccccgcgtg gagaaagggc catcacttca gcaagtgatg cgagaccaac tcaaaccctt
     3781 cacagagccc aggggcaagc cacctagacc gtcagtactg gaggaagcca agaagacagt
     3841 catgaatgtg ctggaacaaa ccatagaacc agctaagcca tggacctact ctcaagcctg
     3901 cgcttcactg gataaaacaa catccagtgg cagccctcat catgtcagga agaatgaaca
     3961 ctggaacggg gaatctttca ctgggcctct tgcagatcaa gcctcaaaag ctaacctaat
     4021 gtatgaggag ggtaaacata tgaaccctat gtacacagca gctctcaagg atgagctggt
     4081 gaaaactgat aaaatctaca agaaaatcaa gaagaggctg ttgtggggat ctgatctggg
     4141 aacaatgctg aggtgcgctc gggcatttgg aggattgctt gacagcatga aagagagctg
     4201 tatctcctta ccctgcagag ttggcatgaa tataaatgaa gatggaccac tcatatttga
     4261 aaaacattct aaatacacct accactatga tgctgattac tctagatggg actcaacaca
     4321 gcagagggct gtactgagtg cagccatgga ggtaatggtg aaattttccg ctgagccgga
     4381 actggcccag gtagttgccg aagacctcct tgcacccagc cgtcttgacg tgggtgattt
     4441 cgtcatctcc gttcaagaag gtcttccatc gggtgtcccc tgcacgtcac agtggaattc
     4501 aatcgctcac tggatcctga ccctcagtgc tatgtccgag gtctctggtc tttcacctga
     4561 ggttgtgcaa gccaactcct gcttttcatt ctatggggat gatgaaatag tcagcacaga
     4621 cataaacctg gatccggaaa aactcaccag gaaactgagg gagtatggcc tcgtcccaac
     4681 taggccagac aaaactgagg gcccacttgt aattacccag gatttgaatg gcctcacatt
     4741 cctgagacga accatagtgc gggaccccgc aggatggttt ggcaaattgg accgtgactc
     4801 catcctaagg cagttgtatt ggaccagagg gcccaaccat gagaacccct ttgaaagcat
     4861 gattccccac tcccagagag caacccagct aatggccctc cttggggaag cctcgttgca
     4921 tggtccccag ttttacaaaa aggtgagtaa aatggtcatc aatgagatca agagtggtgg
     4981 tctggagttt tacgtgccca gacaggaggc catgttcaga tggatgagat tttcagacct
     5041 cagcacgtgg gagggcgatc gcaatctggc tcccgagaat gtgaatgaag atggcgtcga
     5101 atgacgcagc tccatcgaat gatggcgcgg ctggcctcgt accagagatc aaccatgagg
     5161 tcatggccat agaacctgtt gcaggggcct ctttagcagc ccctgtcgta ggacaactca
     5221 atataattga tccctggatt agaaataatt ttgtgcaagc ccctgctgga gaatttactg
     5281 tttcacctag aaatgctcca ggtgaatttt tattagatct agagttaggc cctgagttga
     5341 acccctacct tgctcacctt gcacgcatgt ataatgggca tgcaggtggt atggaggtgc
     5401 agatagtgct tgctgggaat gcgttcacag cgggcaaaat cctgtttgca gttataccac
     5461 ctggattccc ctatgaaaat ttgtcacctg cacaattgac catgtgcccg catgtagtgg
     5521 tggatgtgag gcagcttgaa ccaatcttgc tgcccatgcc agacatccgc aataccttct
     5581 tccattacaa tcagagcaac gggccaaaac ttaggttagt agctatgctt tacacacccc
     5641 taagggctaa taatgctggt gaagatgttt tcacagtttc ttgcagggtt ctgacccgcc
     5701 catcaccaga ctttgaattt aatttccttg tccccccttc tgttgaatct aagactaaag
     5761 cttttacact cccaattctt aagatatctg agatgacaaa ttcaaggttt cccataccag
     5821 ttgaccagat gtatactagt aggaatgaaa atatagttgt tcaaccacag aatggtaggg
     5881 tgacacttga tggagagcta cagggcacaa ccacactaca accggtgtcc atttgtgggt
     5941 tccgagggac actgcagacc aggctggcag accaaccaaa ttacacatac caagtacacc
     6001 ttgagaattt ggacggctca cccgtcgacc cgacagatga agtcccagcc cctttgggaa
     6061 caccagattt ccaggcccag ctgtttggag ttatcagtca aaggagtagt gacaatgcca
     6121 ccagggcaca tgaggccagg gtcaacacca acgatcccac cttcgcacct cagatcgccc
     6181 aggtgcgttt caaatcacca tccaacgact tctttgacaa tgaacccatt aaattcacac
     6241 cagttgggat tagtgttgat agccaaaaca gctacaacca atggctcctt cccaggtatg
     6301 gtgggcacct gacaaacaac actcacctgg ccccctctgt gtccccaatg ttccccggcg
     6361 agcagattct cttcttccgc tcgttcatgc caggtgctag tggtcacact gatggtgcta
     6421 ttgactgcct tttgccacaa gaatgggttg cccatttcta tcaggaggcc gcgactgcgc
     6481 aaacagacgt ggctctgatc agatttgtga atcccgacac aggcagagtg ttatttgaag
     6541 ggaagttaca caagcagggc tttataacca tctctaacag tggggaccac cctattgtta
     6601 tgcccgctaa tgggtacttc aggtttgagg catgggttaa ccagttttat tctctcgccc
     6661 ccgtgggaac tggaagtggg cgcagaagga tccaataatg gctggagctt ttcttgcagg
     6721 tctggctggt gatgtggtga cctctggcat cgggtcgctc atcaatgcag gtgctaatgc
     6781 agtaaaccaa aaggttgaat atgacttcaa taggcaactc caagaagctt ctttcaaaca
     6841 tgacaaggag atgttgaatg cccagatcaa tgccacaacc aaattgcaga gggacatgat
     6901 cgccatcaag cagggggtct tgaccgctgg cggcttttcc cccactgatg ctgcaagagg
     6961 ttccatcaat gctccaacca ccaaaattct tgactggaat gggtccaggt actgggcgcc
     7021 aggatcaatg agaacaacag catactctgg taatttcacc tcacaaggag ttaagcagcc
     7081 cacacctata gttaaatctg tgaaacctca agtacagcaa tctcctgccc cttcttctgt
     7141 ttattctgta gggtctgtta ggtcgcaatc aacacaatca acccaattga cagggtcagg
     7201 gactgtatca agggcaccca ctccctcaac aactacaaca ttgtctagga caagtgagtg
     7261 ggtaaggagt caaaatgata gactgagccc ctttatggga ggcgcgcttc agacagcttt
     7321 cgtcacgccc ccatcgagta aggcttcgtc ttcatcagga acagtctcaa ccgtccctag
     7381 agaaattttg gactcctgga ctcctgcatt taacacgcgc aggcagccgc tcttcgctca
     7441 catacgtaag cgaggggagt cacgggctta gtgaaaagaa tgatttggtt agattatcct
     7501 tctttcttac ctatcttatc tttt
//