Typing tool

Complete norovirus genomes

AB039779  GII.6
 GII.P6

Length: 7,546 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6722
ORF3: 6722..7498
LOCUS       AB039779                7546 bp    RNA     linear   VRL 05-SEP-2002
DEFINITION  Norwalk-like virus genomic RNA, complete genome, isolate:Saitama
            U17.
ACCESSION   AB039779
VERSION     AB039779.1
KEYWORDS    polyprotein; hypothetical protein; capsid; N-terminal, helicase,
            VPg, 3Cpro, RdRp.
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Kojima,S., Kageyama,T., Oka,T.,
            Hoshino,F., Fukushi,S., Shinohara,M., Uchida,K., Suzuki,Y.,
            Gojobori,T. and Takeda,N.
  TITLE     Phylogenetic analysis of the complete genome of 18 Norwalk-like
            viruses
  JOURNAL   Virology 299 (2), 225-239 (2002)
   PUBMED   12202225
REFERENCE   2  (bases 1 to 7546)
  AUTHORS   Katayama,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2000) Kazuhiko Katayama, National Institute of
            Infectious Diseases, Department of Virology II; 4-7-1 Gakuen,
            Musashi-murayama, Tokyo 208-0011, Japan (E-mail:katayama@nih.go.jp,
            Tel:81-42-561-0771, Fax:81-42-561-4729)
FEATURES             Location/Qualifiers
     source          1..7546
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /isolate="Saitama U17"
                     /db_xref="taxon:95340"
     CDS             5..5098
                     /note="N-terminal, helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAC11827.1"
                     /translation="MKMASNDATSAFGSQNSVNDSINTTPSNKEEVGAFSNIKVGLKK
                     MLGAVPKNTKAPSGDRHCPTVKVGSKTLVIPPEPPNGEDIVQFDAKSETVRGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSIYVSGGKALGVHKPP
                     AAISLATVELTPISLYWRPVYTPNYLVHPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLCRRSISRTTGFFKPYQSWNRKPLPTIDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNVFWTPPDVSNFIASLIGDFQLQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMNGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRIDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGDSLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGAALKN
                     VKTLEDLRVALRDVKFNECEIIYRNTKYRVSSDGKGTVSVNKVEDLTSQTANEVSSAL
                     LRLRQARARYYVSCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQETSEPEK
                     ETAQSEWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTRKQRKEERGVLGLVTG
                     TDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGVKELFGVDVKQIQIHKSGEFCRFRFPKPIRPDVSGLVLEEGAPEGTV
                     CSILVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNESLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPTVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHIRKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHMQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MVRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPSKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVISEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPESVNEDGVE"
     CDS             5079..6722
                     /codon_start=1
                     /product="capsid"
                     /protein_id="BAC11828.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQEDTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAPIDMLYTDPNETIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICSFRGTLISQTPRSADSTDSAPRVRNHPLHVQLKNLDGTPYDPTDEVPAVLG
                     AIDFKGTVFGVASQRNTTGSSVGATRAHEVHIDTTNPRYTPKLGSVLMYSESSDFDDG
                     QPTRFTPIGMGADDWHQWELPEYSGHLTLNMNLAPAVAPAFPGERILFFRSVVPSAGG
                     YGSGQIDCLIPQEWVQHFYQEAAPSQSAVALIRYVNPDTGRNIFEAKLHREGFITVAN
                     SGNNPIVVPPNGYFRFEAWVNQFYALTPMGTGQGRRRVQ"
     CDS             6722..7498
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BAC11829.1"
                     /translation="MAGAFFAGLAGDAITNGVGSLINAGANAINQKVEYDFNKQLQLA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLTAGGFSPTDAARGAVNAPITKILDWNG
                     TRYFAPNSMKTTSYSGQFSSNPVHRQPTLSRSDSPKVKINSDSASVYSSTSTAPSQST
                     HSTALTAGSGSSRTTSSSTATSTLSRTSDWVRGQNERLSPFMDGALQTTFVTPPSSRA
                     SSNGSVSTVPKAVLDSWTPMFNTHRQPLFAHLRRRGESQI"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac ctctgccttc ggcagtcaaa actctgtcaa
       61 tgacagtatc aacaccaccc cttccaataa agaagaggtt ggtgcattct ccaacatcaa
      121 agttggactt aagaaaatgc tgggtgccgt gcctaaaaac accaaagcac ccagcggtga
      181 ccggcactgc cccacagtta aggtcgggtc caaaacacta gtgatcccac cagaaccccc
      241 aaacggtgag gacattgtgc agttcgacgc aaaatcagaa actgtgcgtg gactacccga
      301 cctgacgaca gtgcagaatg aacatgagaa caccccgtac acagtccctc cactgagtga
      361 aagggaacac aggccagcca ctgagccact ccccggcaca atattagaga tgtgggatgg
      421 tgaattctac cattactcca tctacgtcag tggaggcaaa gctctggggg tgcacaaacc
      481 cccagcggct ataagcctcg cgacagtgga actcactccc atatcccttt actggcgacc
      541 tgtctacact ccaaactacc tggtccaccc agacacactg aagggtcttg ctggtgaaaa
      601 gtttccctac acggccttta gtaacaactg ctacaatttc tgttgttggg tgcttgaact
      661 taacgacacg tggctttgca ggaggagtat atccagaacc actggcttct ttaaaccata
      721 tcagtcttgg aacaggaagc ccctccccac cattgatgat ggaaaaatca agaaggtggc
      781 caatgcaatt ctctgcgcac ttggctcatt gttctcaaag ccaatcaaag acctactggg
      841 caaactcaag ccacttaacc tactacatct gcttgcgtcg tgtgactgga cgtttgcggg
      901 tatagtagag acagtcatct taatggcgga actcttcaat gtattctgga ccccacctga
      961 tgtttccaat ttcatagcct ccttgatagg tgattttcag ttacaaggac ccgaggactt
     1021 ggctgtggag ctcgtccccg tggttatggg aggcatagga atggtcctcg gtttcactgc
     1081 cgagaagatt ggccgcatgt tgtcatctgc tgcgtcaacc ctaagggcat gcaaagatct
     1141 ggggaactac gccctagaca tactaaaact agtcatgaag tggttctttc caaagaaaga
     1201 agagaaagcc gaaatggaga ccttgagggc gattgaggat gccgtattag acatggaggc
     1261 aatagggaac aaccacctca cgacactcct taaggacaag gacagcctta ctgcatttat
     1321 gaaaacccta gacctagagg aggagaaagc aagaaagcta tcgacgaagt catcctcacc
     1381 agacatcgtc ggcactatca acgccatact ggctagaata gcagccgcta ggtccctcct
     1441 acacaaggcc aaggaagaga tgtttagcag aattagacca gtagttgtca tgatctcagg
     1501 tagacctggc attggtaaaa cccatatggc aaggcatctg gctaagagta tagccaatac
     1561 aatgaatgga gaccagagag ttggacttgt cccgcgcaac ggggttgacc actgggatgc
     1621 ttacaggggg gagagagtgg tcctgtggga cgactatggt atggggaacc ctgtcaaaga
     1681 tgccttgaca ctgcaagaac tggccgacac ctgtccagtc actttgaatt gtgataggat
     1741 tgagaataag gggaagatgt ttgacagtga tgtcatcata atcacgacca acttggtcaa
     1801 ccctgcaccc ctcgattatg tgaacttcga ggcttgctcc aggaggattg atttccttgt
     1861 ctatgcagag tcaccagaaa tagaaaaggt caagagagac ttccctggtc agcctgatat
     1921 gtggaaagat cacttcaaac cggacttttc ccacataaag ctgactttgg ccccccaggg
     1981 cgggtttgat aagaatggca acaccccaca tggtaaaggc accatgcgtt ctctgaccca
     2041 ggggtctctg actgcaagag tggcgggtct tgttcacgag aggagagatg aattccagct
     2101 gcaaggggat agcctacaaa catacaattt tgataccaac agggtctctg cgtttaggaa
     2161 actggccgca gacaacaagt atggaatcat ggagacaatg agagtgggtg cggcactcaa
     2221 gaatgtcaag actttggaag acctcagagt tgctttgaga gatgtaaaat tcaatgaatg
     2281 tgagatcatc tacaggaaca ccaagtaccg ggtctcatct gatggcaaag gcacagtctc
     2341 tgttaacaaa gtcgaggacc tcacttccca aaccgcaaac gaggtgagtt cagccctcct
     2401 caggctcaga caagccaggg ccagatatta tgtcagctgc ttccaggacc ttgtctacac
     2461 tctcatacag gtcgctgggg cttcatttgt cgtcaacagg atctccaaga ggttctgctg
     2521 ggaaagatgg gtaaaaccga ccgagaccca ggagacgagt gagcccgaga aggaaactgc
     2581 ccagagtgaa tgggagattg aacccaagga cacagaacca gaaggtaaga agggcaaaaa
     2641 caagaaagga aggggcaaga aacacacagc cttctccagt aaaggcctga gtgatgaaga
     2701 gtatgatgag tacaaaagga ttagggaaga aagaaatgga aagtactcca ttgaggaata
     2761 ccttcaagac cgtgaccgct actacgaaga agtagcagtt gcccgagcaa cagaggagga
     2821 cttctgtgaa gaggaagagg ccaagataag gcaaagaatc ttccgcccaa caaggaagca
     2881 aagaaaagag gaaaggggtg tgcttggtct agtcactggc acggatatca ggaagagaag
     2941 accagatgac ttccaaccaa agggcaactt gtgggcagat gacactagga gtgtggacta
     3001 caatgagaga cttgacttcg aggccccccc aagcgtgtgg tcaaggatag tcccactggg
     3061 caccggctgg ggcttctggg tctcatccaa cctcctaatt acaacaacac atgtcctgcc
     3121 taagggtgtt aaggaactct tcggcgtcga cgtcaaacaa atccaaatcc acaaatctgg
     3181 agaattttgc aggtttagat tcccaaaacc aatcagacca gacgtctcag ggcttgtatt
     3241 ggaagaaggt gcaccagagg gcactgtctg ctccatactc gtgaagagac caacaggtga
     3301 gatgatccct ctagcggtga gaatgggcac gcatgcatct atgaaaatcc agggcaggac
     3361 tgttggtggc caaatgggaa tgctcctcac tggggcgaac gcaaagaaca tggacctcgg
     3421 caccggcccg ggagattgcg gttgcccata catttacaag cgcggcaatg acatagtcgt
     3481 ggcaggtgtc cataccgcag cggcccgagg aggcaacact gtcatctgtg ccactcaagg
     3541 gcaggacggg gaagcagttc ttgaagggaa tgagagcctt ggcacttact gtggtgcccc
     3601 aatcctaggt cctggcaagg cgcccaagct cagcacgaag accaagttct ggcgctcatc
     3661 gcctgatgcc ctgccacccg gcacatatga acctgcctac ctaggaggca aagaccccag
     3721 agtagagaag ggaccttccc tgcagcaagt catgagggat cagttgaaac ctttcacgga
     3781 acccaggggc aaaccaccaa gacccacagt cctggaagaa gctaaaaaga cagtaatgaa
     3841 tgtcctggaa cagaccattg accctgctaa accgtggact tactcacaag catgtgcttc
     3901 cttggataag accacttcca gtggcagccc ccatcacatc aggaagaacg accattggaa
     3961 cggagagtct tttacaggcc ccctcgcaga ccaagcatcc aaagctaatc tcatgtatga
     4021 gcaggccaaa cacatgcagc ctgtgtacac agctgcactc aaggatgagc tcgtcaaaac
     4081 tgacaaaatt tacaagaaga taaagaagag gctcctatgg gggtcggacc ttggcacaat
     4141 ggtcaggtgc gccagggcct ttggtggtct catggacagc atgaaagcaa gttgcatagc
     4201 cttaccgtgc agagtgggaa tgaacatgaa tgaggacggg cctatcattt ttgacaagca
     4261 ctccaaatac agataccact atgatgctga ctactctagg tgggactcaa ctcaacaaag
     4321 aagcatcttg tccgccgcca tggaagtgat ggtgcggttc tctgcagaac cagaattggc
     4381 acaagtcgtt gcagaggacc tcttagcacc cagccagctg gacgttggcg actttgtcat
     4441 ctcagttcag gaaggcctac catcaggagt cccgtgcacg tcacaatgga attcaatagc
     4501 ccactggatc ttgactttga gtgcaatggc agaagtgtca ggcctctcgc cagatgttgt
     4561 gcaagcccat tcctgtttct ctttctatgg tgatgatgag attgtgagca ctgacatcaa
     4621 ccttgaccct tcaaaactga cacagaaact cagggagtat ggtctggtcc ccacccgacc
     4681 tgacaaaact gaaggccccc tggtcataac tgaggacctc accggcctaa cattcctgcg
     4741 caggtcgatt gcgcgggacc ccgctgggtg gtttgggaag ctggatcaag actcaattct
     4801 caggcagttg tattggacaa gagggcccaa ccatgagaac ccatatgaaa gcatggtccc
     4861 ccactcccaa cgggccacac aactcatggc ccttcttggt gaagcttcat tacacggacc
     4921 ccaattctac aagaaggtca gtaagatggt tatcagtgag atcaagagtg gtggtctgga
     4981 gttttatgtg cccagacaag aggccatgtt taggtggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gagtgtgaat gaagatggcg tcgaatgacg
     5101 ctgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaacaat gaggttatgg
     5161 cacttgaacc ggtggtggga gcctcaattg cagctcctgt cgtcggtcaa caaaatataa
     5221 ttgacccctg gattagagaa aattttgttc aggcaccaca gggtgagttt actgtttcac
     5281 caagaaactc gcctggtgag atgcttttaa atcttgaatt aggcccagag ctcaatcctt
     5341 acctgagtca tttatcccgc atgtataatg gttatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaacgcgttc acagctggta aaatcatctt tgccgccgtt ccaccacatt
     5461 tccctgtaga gaatattagt gcagctcaaa tcacaatgtg cccccatgtg attgttgatg
     5521 tgagacaact tgagcctgtg cttttgcccc tccctgacat aaggaataga ttctttcact
     5581 acaaccagga agacaccccc cggatgagac ttgtggccat gttgtataca ccccttagag
     5641 caaactctgg tgaggacgtg ttcacagtgt cttgcagggt cttgacccgc ccagcccctg
     5701 actttgagtt cacgttctta gtgccaccaa ccgtagaatc aaagactaag cctttcacac
     5761 tccctatttt aaccctgggg gaactatcca attccagatt tcctgctcca atagacatgc
     5821 tgtacacaga tcccaatgag acaattgtgg tacaaccaca aaatggcaga tgcaccctag
     5881 atgggacact ccaagggacc acccagctgg tgcctaccca aatttgctct tttaggggca
     5941 cgttaattag ccaaacgccg aggtctgcag attcaacaga ttcagctcca cgggtgagga
     6001 accaccccct ccacgttcag ctgaagaacc tcgacgggac accatatgac ccaacagatg
     6061 aggtaccggc agtcctgggt gccatagatt tcaaaggaac tgtgtttgga gttgctagcc
     6121 agagaaacac cacagggagc tctgtagggg cgacccgtgc ccatgaggtg cacatagaca
     6181 ccacaaaccc tagatacacc ccaaaacttg gttctgtgtt gatgtattct gagtctagtg
     6241 attttgatga tggacaacca actcgcttta cccccattgg catgggagca gatgattggc
     6301 accaatggga attgcccgaa tattccggtc acctcactct taacatgaac ctagcccccg
     6361 cagttgcccc tgctttcccc ggtgagcgca ttctcttctt caggtcagtg gttccatctg
     6421 ctggtggtta cggatcaggt caaatagact gcctcatccc acaggagtgg gttcagcact
     6481 tctaccagga ggccgcccca tcacaatctg cggtggctct tattagatat gttaaccctg
     6541 acactgggag aaacatcttt gaggcaaagc tacatagaga agggttcatc actgtggcaa
     6601 attctggaaa caaccccata gttgtgcccc caaatggtta tttcaggttt gaggcctggg
     6661 tcaatcaatt ctatgcactc acccccatgg gaactggaca ggggcgtagg agagtccaat
     6721 aatggcagga gctttctttg ctggattagc aggcgacgcc ataacaaatg gtgtcgggtc
     6781 cctgatcaac gctggggcca atgcaattaa tcagaaggta gaatatgatt tcaacaaaca
     6841 actccaattg gcatccttta aacatgacaa ggaaatgctg caatcacaag ttctggccac
     6901 caaacagctc cagcaggaaa tgatgaacat aaggcaaggg gtcttgaccg ctggcggctt
     6961 ttcccctaca gatgccgcga gaggcgctgt aaacgcgcca ataacaaaaa ttttggattg
     7021 gaatggcaca agatattttg ctccaaatag catgaaaaca accagttatt cgggtcagtt
     7081 ctccagcaat cctgtgcaca ggcaacccac tttgtcccgt tctgattccc caaaagttaa
     7141 aattaatagt gattctgcta gtgtatatag ttctacatcc accgctcctt cacaatcaac
     7201 ccattctacg gctctgactg cagggtctgg atcatccagg acaacctcct cttccacagc
     7261 aacttctacc ctatctagga ccagtgactg ggtgagggga caaaatgaga ggcttagccc
     7321 gttcatggat ggtgctctcc aaacaacttt tgtcacacca ccatcgagca gagcttcatc
     7381 aaatgggtcg gtctcaaccg ttcccaaagc tgttttggac tcctggactc ctatgtttaa
     7441 cacccatagg cagcctctct tcgctcactt gcgtaggcga ggggagtcac aaatttagtg
     7501 aaaagattga ttaggttttc ttctccttct ttctcctttc ttcttt
//