Typing tool

Complete norovirus genomes

AB039777  GII.6
 GII.P7

Length: 7,564 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6731
ORF3: 6731..7510
LOCUS       AB039777                7564 bp    RNA     linear   VRL 05-SEP-2002
DEFINITION  Norwalk-like virus genomic RNA, complete genome, isolate:Saitama
            U4.
ACCESSION   AB039777
VERSION     AB039777.1
KEYWORDS    polyprotein; hypothetical protein; capsid; N-Tterminal, helicase,
            VPg, 3Cpro, RdRp.
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Kojima,S., Kageyama,T., Oka,T.,
            Hoshino,F., Fukushi,S., Shinohara,M., Uchida,K., Suzuki,Y.,
            Gojobori,T. and Takeda,N.
  TITLE     Phylogenetic analysis of the complete genome of 18 Norwalk-like
            viruses
  JOURNAL   Virology 299 (2), 225-239 (2002)
   PUBMED   12202225
REFERENCE   2  (bases 1 to 7564)
  AUTHORS   Katayama,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2000) Kazuhiko Katayama, National Institute of
            Infectious Diseases, Department of Virology II; 4-7-1 Gakuen,
            Musashi-murayama, Tokyo 208-0011, Japan (E-mail:katayama@nih.go.jp,
            Tel:81-42-561-0771, Fax:81-42-561-4729)
FEATURES             Location/Qualifiers
     source          1..7564
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /isolate="Saitama U4"
                     /db_xref="taxon:95340"
     CDS             5..5098
                     /note="N-terminal, helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAC11821.1"
                     /translation="MKMASNDATAALGSQNSVNDSVNTTPSNKEEVGAFSNIKVGFKK
                     MLGAVPKGTKAPSSDQHCPTVKIGPKTLTVPPEPPNGEDTVQFDAKSETISGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSVYVSGGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVCPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLSRRSISRTTGFFKPYQSWNRKPLPTVDDGKVKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNVFWTPPDVSNFIASLIGDFELQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKNIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRVDFLVYAESP
                     EIEKVKRDFPGQPDMWKDYFKQDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERKDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIVETMRVGAALKN
                     VKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDKVEDHTSQTANEVSSAL
                     LRLRQARARYYISCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQEASEPEK
                     EVAQGRWEIEPKDAEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTRKQRKEERGVLGLVTG
                     SDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGVKELFGVEIKQIQIHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSILIKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNENLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHIKKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHVQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITENLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     CDS             5079..6731
                     /codon_start=1
                     /product="capsid"
                     /protein_id="BAC11822.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSPMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVDNISAAQITMCPHVIVDVRQLEPVPLPLPD
                     IRNRFFHYNQENTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAAIDMLYTDPNESIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICAFRGTLISQTARAADSTDSPQRARDHPLHVQVKNLGGTQYDPTDDIPAVLG
                     AIDFKGTVFGVASQRDVSGPQEQGHYATRAHEAHIDTTDPKYAPKLGTILIKSESNDF
                     TTNQPIRFTPVGMGDNNWRQWELPDYSGRLTLNMNLAPAVSPSFPGERILFFRSIVPS
                     AGGYGSGYIDCLIPQEWVQHFYQEAAPSQSAVALVRYVNPDTGRNIFEAKLHREGFLT
                     VANSGNNPIVVPPNGYFRFEAWVNQFYTLAPMGSGQGRRRAQ"
     CDS             6731..7510
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BAC11823.1"
                     /translation="MAGAFFAGLAGDVVSNGIGSLINAGANAVNQKVEYDFNKQLQMA
                     SFKHDKEMLQSQVLATKQLQQEMMNIKQGMLTAGGFFPADAARGAVNAPMTKILDWNG
                     TRYWAPNSMKTTSYSGQFSSSPVHRSPAPPQHTAPPKSKLQSDSASVYSSPSTVSSQS
                     THSTMLSAGTGSSRSISTSTATSTLSRTSDWVRGQNERLSPFMDDALQTTFVTPPSSK
                     ASSNGTVSTVPKAVLDSWTPMFNTHRQPLFAHLRRRGESQI"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgctgccctt ggcagtcaaa actctgtcaa
       61 tgacagtgtc aacaccaccc cttcaaataa agaagaggtt ggtgcatttt ccaacatcaa
      121 agttggattt aagaagatgc tgggtgccgt acctaagggc actaaagcac ccagcagtga
      181 ccagcactgc cccacagtta agatcgggcc caaaacacta acagtccccc ctgaaccccc
      241 aaatggtgaa gacaccgtac agtttgatgc aaagtcagaa actataagtg ggctaccgga
      301 cttgacaaca gtgcaaaatg aacacgaaaa taccccatac actgtccctc cattaagtga
      361 gagggaacac agaccagcca ctgagccgct tcctggcaca atattggaga tgtgggatgg
      421 tgaattctac cactattccg tgtacgtcag cggcggcaaa gctctagggg ttcacaagcc
      481 cccggcagct ataagcctcg cgacgataga gctcaccccc atatctctat actggaggcc
      541 cgtttacacc cccaactacc tggtctgccc agacacattg aaaggtctcg ctggtgaaaa
      601 gttcccctac acggccttca gtaacaattg ttataacttc tgttgctggg tgcttgagct
      661 caatgacacg tggcttagta gaagaagcat ctccagaact accggcttct tcaaaccata
      721 ccagtcttgg aacaggaagc ctctcccaac cgttgatgat ggaaaagtca aaaaggtggc
      781 caacgcgatc ctctgtgcac tcggctcgct gttctcaaag ccaattaaag acctgttagg
      841 caagctcaaa ccattgaact tgctacactt gctcgcgtca tgtgattgga cgtttgcagg
      901 tatagtggag acagtcatct taatggcgga acttttcaac gtcttttgga ctccgccaga
      961 tgtctctaat ttcatagcct ccctgatagg tgattttgaa ttgcaggggc ctgaggactt
     1021 ggctgtggag cttgttcccg tggtcatggg cggtatagga atggttcttg gcttcaccgc
     1081 tgagaagata ggtcgcatgc tgtcgtccgc tgcatcaaca ctgcgggcat gcaaagacct
     1141 agggaactat gcccttgaca tacttaaatt ggtcatgaag tggttcttcc caaagaaaga
     1201 ggagaaagcc gagatggaaa ccttaagggc gattgaggat gccgtcctag atatggaggc
     1261 tatagggaac aaccatctca cgaccctcct caaggataag gacagtctca cggctttcat
     1321 gaagaccctg gacctagaag aggagaaggc aaggaagcta tctaccaaat catcctcgcc
     1381 ggacatcgtc ggcactatca acgccatact ggctagaata gctgccgcca gatccctcct
     1441 gcacaaggcc aaagaagaga tgttcagtag gatcagacca gtggttgtca tgatctcagg
     1501 cagacctggc attggcaaaa cccatatggc aaggcatttg gctaaaaaca tcgccaacac
     1561 catgagtggt gaccagagag tcgggctcgt tccgcgcaac ggagtcgacc actgggacgc
     1621 ctacagggga gagagagtgg ttttatggga cgactatggc atgggaaacc ccgtcaaaga
     1681 tgctttaaca ctacaagaat tggctgacac atgcccagtc actctaaatt gtgataggat
     1741 cgagaacaag gggaagatgt ttgacagtga tgtcatcata attacgacca atctagttaa
     1801 tcctgcacct ctcgattatg tgaacttcga ggcgtgctct agaagagttg acttcttggt
     1861 ctatgcagag tcaccagaaa ttgaaaaggt taagagagat ttccctggtc aacctgacat
     1921 gtggaaagat tatttcaaac aagacttttc ccacataaag ctgactctgg cccctcaggg
     1981 cggatttgac aagaatggca acaccccgca tggtaagggt accatgcgat ccctaactca
     2041 agggtccctg actgcaagag ttgcaggcct tgttcatgag aggaaggatg agttccagct
     2101 acaagggaac gaccttcaaa catacaactt tgacaccaac agggtctccg cattcaggaa
     2161 gctggccgca gacaacaagt atggaatcgt ggaaacaatg agagtgggtg cggcactcaa
     2221 aaacgtcaag actttggaag atctgaaagt tgccttgagg gatgtaaaat tcaatgagtg
     2281 tgaaataatt tacaggaact ccaagtatcg agtctcttcc aacggtaagg gctctgtttc
     2341 tgttgacaaa gttgaggacc acacatctca gactgcaaac gaggtgagct cagcactcct
     2401 cagactcaga caggcaaggg ccagatatta tatcagctgc ttccaagacc tcgtctacac
     2461 tctcatacag gttgctgggg catccttcgt tgttaacaga atctccaaaa ggttctgctg
     2521 ggaaaggtgg gtaaaaccaa ccgagaccca agaagcgagt gagcccgaaa aggaagtggc
     2581 tcaaggtaga tgggagattg agcccaagga cgcagaacca gaaggcaaga agggcaagaa
     2641 caagaaagga agaggcaaga aacacacagc tttctccagc aaaggcctga gtgatgaaga
     2701 gtatgacgag ttcaagagaa tcagagaaga gaggaacgga aaatactcca ttgaggaata
     2761 cctgcaagac cgggaccgct actatgaaga agtggcagtt gcccgtgcaa cagaggagga
     2821 tttctgtgaa gaggaagagg ccaagataag acaaagaatc ttccgtccga caaggaaaca
     2881 gagaaaggag gaaagggggg tgcttggatt ggtcactggc tcagacatca gaaagaggag
     2941 accagacgat tttcaaccaa aaggcaacct gtgggcagat gacaccagga gtgtagacta
     3001 caatgagaga cttgacttcg aggctccacc aagcgtctgg tcaagaatag tcccattggg
     3061 tactggttgg ggtttctggg tttcatccaa cctcctgatc acaacaacac acgtcctgcc
     3121 caagggggtc aaggaactct ttggagttga aatcaaacaa atccaaattc acaagtctgg
     3181 agagttttgt aggtttagat tcccaagacc aatcaggcca gatgttacgg ggctcgtgtt
     3241 ggaggaaggt gctccagaag gcactgtctg ctccatactc ataaagagac ctacaggtga
     3301 gatgatcccc ctagcagtga ggatgggcac gcatgcatcc atgaaaatac agggtaggac
     3361 cgtcggtggc cagatgggga tgcttctcac aggggcaaac gcgaagaaca tggatcttgg
     3421 caccggtcct ggtgactgcg gttgccctta catctacaaa cgtggcaatg acatagttgt
     3481 cgcgggtgtc cacaccgcag cagcccgggg gggcaatact gttatatgtg ccactcaagg
     3541 gcaagatggg gaggcagtcc ttgaaggaaa tgaaaacctt ggtacttact gtggtgcccc
     3601 aattttgggt cctggcaagg cgcctaaact cagtacgaag accaaatttt ggcgctcatc
     3661 accagatgcc ctacctcctg gcacatatga acctgcttac ctgggaggta aggaccccag
     3721 agtagaaaaa gggccctccc tgcagcaagt catgagagac cagctgaaac ccttcacaga
     3781 gcccaggggc aagccaccta gaccagcagt tttagaagaa gctaaaaaga cagtgatgaa
     3841 tgttctagaa caaaccattg accctgctaa gccatggacc tactcgcaag catgtgcttc
     3901 actggacaag accacttcta gtggtagccc ccaccatatc aagaaaaatg accattggaa
     3961 tggagagtct ttcactggtc cccttgcgga tcaagcatct aaagccaacc tcatgtatga
     4021 acaggcaaaa catgtgcagc ccgtgtacac ggccgcgctc aaagatgagc ttgttaagac
     4081 tgataagatc tacaaaaaga taaagaagag gcttctatgg gggtcggacc ttggtacgat
     4141 gatcaggtgt gccagggctt ttggcggcct catggacagt atgaaagcaa gttgcatagc
     4201 ccttccatgc agggtgggga tgaatatgaa tgaggatggc cccatcatat ttgacaaaca
     4261 ctctaagtat aggtaccact atgatgctga ctactctaga tgggattcaa cccagcaaag
     4321 gagcattctt tctgccgcta tggaggtgat ggtgcggttc tctgctgaac cagaattggc
     4381 acaagtggtc gcagaggacc ttctggcacc tagccagcta gatgttggcg attttgtcat
     4441 ctcagttcag gagggtctgc catcaggagt cccatgtaca tcacaatgga attcaatagc
     4501 acactggatt ctaactctga gcgcaatggc agaagtatca ggtctctcac cagatgttgt
     4561 tcaagcccac tcctgttttt cattttatgg cgatgatgag atcgttagca ctgacataaa
     4621 ccttgacccc atgaaactga cacagaaact cagggagtac ggtctggtcc ccacccgacc
     4681 tgataaaact gaaggtcccc tcgtcataac tgaaaacctc accggcctga cgttcctgcg
     4741 taggtcgatt gcacgggatc cagctgggtg gtttggaaaa ttggatcaag actcaattct
     4801 caggcaatta tactggacaa gggggcccaa tcatgagaac ccgtacgaga gcatggttcc
     4861 ccattctcag cgagccacac agctcatggc ccttcttggt gaggcctcat tgcatggccc
     4921 ccagttttac aagaaagtta gcaagatggt catcaatgag attaagagtg gtggtctgga
     4981 attttatgtg cccagacaag aggccatgtt taggtggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gggtgtgaat gaagatggcg tcgaatgacg
     5101 ccgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaacaat gaggttatgg
     5161 cacttgaacc ggtggtagga gcctcaatcg cagctcctgt tgtcggtcag caaaatataa
     5221 ttgacccctg gattagagaa aattttgtcc aagcaccaca gggcgagttt actgtttcgc
     5281 caaggaattc gcctggtgag atgcttttaa accttgagtt gggcccagaa cttaacccct
     5341 atttgagtca tttgtccccc atgtacaacg gatatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggga aaatcatctt tgccgccgta ccaccacatt
     5461 ttcctgtgga taatattagt gcagcccaga taactatgtg tccccatgtg attgttgatg
     5521 tgagacagct tgaaccagtg cctctgcccc tccccgatat aaggaatagg ttcttccatt
     5581 acaatcagga gaacaccccc cggatgagac tcgtggccat gctctacacg cccctgaggg
     5641 ccaattctgg tgaagacgtg ttcactgtgt cttgtagggt tttgactcgc cccgctccag
     5701 attttgagtt tacattctta gtaccaccaa ctgttgaatc aaaaacaaaa ccttttaccc
     5761 tacctattct aactcttggt gagttgtcta actcccgttt tccggctgct atagatatgc
     5821 tttatactga tcccaatgaa tcaatagttg ttcaacccca aaatggtagg tgcactcttg
     5881 atggcacatt gcaaggcaca acacaattgg ttccaacaca gatttgtgct tttagaggca
     5941 ccctgatcag ccagaccgcg agagcggccg actcaacaga ttctccccag agagcccgtg
     6001 atcatccatt acacgtccag gtcaagaacc taggcggcac acagtatgac ccaacagatg
     6061 acatacctgc agtcctgggg gctattgact tcaaaggcac agtatttgga gtggctagtc
     6121 agagggatgt ctctggacca caagaacagg gccactatgc cacccgagcc catgaagcac
     6181 acattgatac aactgaccca aagtatgcac ccaaattagg cacaattctt atcaaatctg
     6241 aatccaatga tttcaccaca aatcaaccca ttaggttcac tccagtgggc atgggtgata
     6301 acaattggag gcagtgggaa ttacctgatt attctggcag attaacctta aatatgaacc
     6361 ttgcccccgc tgtttcccca tctttccctg gtgaacgaat ccttttcttt aggtctatag
     6421 taccatcagc tggaggctac gggtctggct atatagactg tctcataccc caggaatggg
     6481 tgcaacactt ctaccaggaa gcagcacctt cacaatccgc tgtcgcactg gttaggtatg
     6541 ttaaccccga tactgggcgt aacatctttg aggccaagtt gcacagagaa gggttcctca
     6601 ccgtggccaa ttctggaaac aatcctattg tagttccccc taatggttat tttagatttg
     6661 aggcttgggt taatcagttt tacacacttg cccccatggg atctggacag gggcgtagaa
     6721 gggcccagta atggctggcg ccttcttcgc aggattagca ggtgatgtcg tgtcgaacgg
     6781 catcggttcc ctcatcaatg caggtgccaa tgcagtcaat caaaaggttg agtatgattt
     6841 caataagcaa cttcagatgg catcattcaa acatgacaag gagatgttac aatcacaggt
     6901 gttggcaact aaacagctac agcaggaaat gatgaacata aagcaaggga tgttgaccgc
     6961 tggcggcttc ttccctgcgg atgctgctag aggggctgtt aatgctccaa tgacaaaaat
     7021 actggactgg aatggcacaa ggtattgggc acctaacagt atgaaaacca caagctattc
     7081 agggcaattt tctagtagcc ccgtccacag gtctcctgct cctccccaac acactgctcc
     7141 accaaaaagt aagttgcaaa gtgattctgc tagtgtgtat agctccccct ctactgtttc
     7201 ttcacaatca acccattcaa caatgttgtc tgcaggaact gggtcgtcca gatccatctc
     7261 cacgtccaca gcaacctcta ccttgtctag aaccagcgac tgggttagag gacagaatga
     7321 aaggcttagc ccgttcatgg atgatgctct ccaaactacc tttgtcacac caccatcgag
     7381 caaggcttca tcaaatggga cggtctcgac cgtgcccaaa gctgttttgg actcctggac
     7441 tcctatgttc aacacacata ggcagcctct cttcgcccat ttgcgtaggc gaggggagtc
     7501 acaaatttag tgaaaagagt gattaggctt tcttcccctt tttctttctc cttttctctc
     7561 tttt
//