Typing tool

Complete norovirus genomes

AB039775  GII.12
 GII.P12

Length: 7,521 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6692
ORF3: 6692..7471
LOCUS       AB039775                7521 bp    RNA     linear   VRL 05-SEP-2002
DEFINITION  Norwalk-like virus genomic RNA, complete genome, isolate:Saitama
            U1.
ACCESSION   AB039775
VERSION     AB039775.1
KEYWORDS    polyprotein; hypothetical protein; capsid; N-terminal, helicase,
            VPg, 3Cpro, RdRp.
SOURCE      Norwalk-like virus
  ORGANISM  Norwalk-like virus
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1
  AUTHORS   Katayama,K., Shirato-Horikoshi,H., Kojima,S., Kageyama,T., Oka,T.,
            Hoshino,F., Fukushi,S., Shinohara,M., Uchida,K., Suzuki,Y.,
            Gojobori,T. and Takeda,N.
  TITLE     Phylogenetic analysis of the complete genome of 18 Norwalk-like
            viruses
  JOURNAL   Virology 299 (2), 225-239 (2002)
   PUBMED   12202225
REFERENCE   2  (bases 1 to 7521)
  AUTHORS   Katayama,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-MAR-2000) Kazuhiko Katayama, National Institute of
            Infectious Diseases, Department of Virology II; 4-7-1 Gakuen,
            Musashi-murayama, Tokyo 208-0011, Japan (E-mail:katayama@nih.go.jp,
            Tel:81-42-561-0771, Fax:81-42-561-4729)
FEATURES             Location/Qualifiers
     source          1..7521
                     /organism="Norwalk-like virus"
                     /mol_type="genomic RNA"
                     /isolate="Saitama U1"
                     /db_xref="taxon:95340"
     CDS             5..5104
                     /note="N-terminal, helicase, VPg, 3Cpro, RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="BAC11815.1"
                     /translation="MKMASNDASAAAAANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEPVVSYSVKDGVSGLPELTTVRQPG
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGRQLKDVRTM
                     PELKQALKNISIKSCQIVYGGCTYMLESDGKGDVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETASKDGC
                     PKPKDDDEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6692
                     /codon_start=1
                     /product="capsid"
                     /protein_id="BAC11816.1"
                     /translation="MKMASSDAAPSNDGAAGLVPEANNETMALEPVAGASIAAPLTGQ
                     NNIIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPTLTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELRGTT
                     QLLPTAICPFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATNSAKFTPKLGAIQIGTWEEDDVHINQPTKFTPVGLFEN
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGERILFFRSHIPLKGGVADPVIDCLLHQ
                     EWIQHLYQESAPSQSDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6692..7471
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="BAC11817.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQVQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGATKTTAFSGGFTNASHAGTVDLTKKTSATPAPTSVSRPSSIASTVSTRSTL
                     VSGSFNPSSSARSSSSVSSQPTSSSSRTSEWVRSQNRALEPYMRGALHTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWTSAFNTRRQPLFAHLRRRGESQV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggca cggcctaaac agcctccccc gagggaaata ccacaaaggc ccccacgacc
      181 ccccacccca gaactggtca aaaagatccc tcctcctcca cccaacgggg aggatgaacc
      241 agtggtttct tacagcgtca aagatggcgt ttccggcttg cctgagctta ccactgtcag
      301 gcagccgggt gaaaccaaca cggcgttcag tgttccccca ctcaaccaaa gggagaatag
      361 ggacgccaag gagccactaa ctggaacaat cctggaaatg tgggacgggg agatctacca
      421 ttacggcctg tatgtggaac gaggtcttgt acttggtgtg cacaaaccac cggctgccat
      481 cagcctcgcc aaggttgaac taacaccact ctctctgttt tggagaccag tgtatacacc
      541 acagtatctc atctctccag acactctcag gagactgcac ggagagtcgt tcccctacac
      601 agcctttgac aacaactgct atgccttctg ttgttgggtc ctggacctaa acgactcgtg
      661 gttgtgcagg agaatgatcc agaggacaac tggtttcttc aggccttacc aagactggaa
      721 taggaaaccc cttcccacca tggatgactc caagttgaag aaggtagcta acatattctt
      781 gtgtgcgcta tcttcgctat tcactaggcc catcaaagac ataataggaa agttgaggcc
      841 tcttaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 tttgatcctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgcccct ttactaggtg actacgagct gcaggggccc gaggaccttg cagtggaact
     1021 cgttccaata gtgatggggg ggattggttt ggtgctagga ttcaccaaag agaagatcgg
     1081 gaaaatgttg tcatctgctg catccacctt aagagcttgt aaagaccttg gtgcatacgg
     1141 actggaaatc ttaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgaggtcca tcgaggatgc ggtgctggac ctcgaggcaa ttgagaacaa
     1261 tcacatgact gccctcctca aagacaaaga cagcctggca acctatatga gaactcttga
     1321 cctcgaggag gagaaagcca ggaagctttc aaccaagtct gcttcacctg atatcgtggg
     1381 cacaatcaac gctctcctgg cgagaatcgc cgctgcacgt tccctggtgc atcgggcgaa
     1441 agaggagctc tccagcagac caagacctgt tgttgttatg atatcaggca ggccagggat
     1501 agggaaaacc caccttgcca gggaattggc caagagaatc gcagcttctc tcacagggga
     1561 ccagcgtgtg ggtctcatcc ctcgcaatgg tgttgatcac tgggacgcat ataagggaga
     1621 aagagtcgtc ctatgggacg attatggaat gagtaatccc atccacgacg ccctcaggtt
     1681 acaagaactt gctgacacct gccccctcac gctaaattgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaac ctggccaacc cagcaccact
     1801 ggactatgtc aattttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagatgc
     1861 ccctgaggtc gagaaggcaa agcgtgattt cccaggtcaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gacttctcgc acataaaact gatgctggct ccgcagggtg gcttcgacaa
     1981 gaacggaaac accccacatg ggaaaggcgt catgaaaacc ctcaccactg gttccctcat
     2041 cgctcgagca tcagggctac tccatgagag gttagatgag tacgagctgc agggcccaac
     2101 ccccaccacc ttcaactttg accgcaacaa ggtgcttgcg ttcagacagc ttgctgccga
     2161 aaacaagtac gggttgatgg acacaatgag agttggaaga cagctcaagg atgtcaggac
     2221 catgccagag ctcaaacaag cactcaagaa tatctcaatc aagagttgtc agatagtgta
     2281 tggtggctgc acctatatgc ttgagtctga tggcaagggt gatgtgaaag ttgacagagt
     2341 tcagaacgcc actgtacaga ccaacaatga acttgccggt gccctacacc atcttaggtg
     2401 tgccagaatt agatactatg tcaagtgtgt tcaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtaa ccacgcgcat tgtcaagcgc atgaacatac aagacctttg
     2521 gtccaagcca caggtggaag atacagagga gactgctagc aaggatgggt gcccaaaacc
     2581 caaggatgat gacgagttcg ttgtctcatc cgacgacatc aaaaccgagg gcaagaaagg
     2641 gaagaacaag tctggccgtg gtaagaagca cacagcattc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca aaagaatcag agaagaaaga aacggcaaat actccataga
     2761 ggaatacctt caggacagag acaagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaagaag aagaggccaa gatccgacaa aggattttca ggccaacaag
     2881 gaaacaacgc aaagaggaga gggcctctct cggtttggtc acaggctctg aaatcaggaa
     2941 gaggaaccca gacgacttca agcctaaagg aaagctgtgg gctgatgacg acaggagtgt
     3001 tgactacaat gagagactca attttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggatca ggttggggct tttgggtttc ccccagcctg ttcataacat caactcatgt
     3121 cataccccag ggcgcacagg agttctttgg ggtttccatc aaacaaattc agatacacaa
     3181 atcgggtgaa ttctgtcgct tgaggtttcc aaaaccaatc agaactgacg tgacaggcat
     3241 gatcctagaa gaaggtgcgc ccgaagggac cgtggtcaca ctactcatca agaggccaac
     3301 tggagaactc atgcccttgg cagccagaat gggaacccat gcaaccatga agattcaagg
     3361 gcgcactgtt gggggtcaaa tgggcatgct cctaacagga tccaacgcca agagtatgga
     3421 tctgggcacc acaccaggtg actgtggctg tccctacatt tacaagaggg ggaatgacta
     3481 cgtagtcatt ggagtccaca cggctgctgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggagc gagggagaag ccacacttga aggcggtgac aacaagggaa cctactgtgg
     3601 tgcaccaatc ttaggtccag gaagcgcccc aaagctcagc accaagacta agttctggag
     3661 atcatccaca gcaccactcc cacctggtac ctatgagcca gcctaccttg gcggcaagga
     3721 ccccagagtc aagggtggcc cttcattgca acaagttatg agggaccagc tgaaaccatt
     3781 caccgagccc aggggtaaac caccaaaacc aagtgtgtta gaggctgcca agaaaaccat
     3841 catcaatgtt cttgaacaaa caattgatcc acctcaaaaa tggtcattcg cgcaggcatg
     3901 cgcatccctc gacaagacca cttccagtgg tcacccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttta caggcaaatt ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaagag ggaaagaaca tgaccccagt ctacacaggt gcgcttaagg acgagctggt
     4081 caagactgac aaaatttatg gcaagatcaa aaagaggctt ctctggggct cggatctggc
     4141 gaccatgatc cggtgcgctc gagcgtttgg gggcctgatg gaggaactca aagcacattg
     4201 tgtcacacta cccgtcagag taggtatgaa tatgaatgag gatggtccta tcatctttga
     4261 gagacactcc agatacaaat accattatga tgctgattac tcccggtggg actcaacaca
     4321 acaaagagcc gtgttagcag cagccttaga aatcatggtt aagttctccc cagaaccgca
     4381 tctggcccaa aaggttgcag aagaccttct ctctcccagc gtgatggacg taggtgactt
     4441 caaaatatca atcaatgagg gcctcccctc cggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctctgtgc actttctgag gttacaaacc tgtcccctga
     4561 cattatccag gccaactctc tcttttcctt ctacggtgat gatgaaattg tgagcacaga
     4621 cataaagttg gacccagaaa agttgacagc aaaacttaag gaatacgggt tgaaaccgac
     4681 ccgccctgat aagactgagg gaccccttgt tatctctgag gacctgaatg gcctaacctt
     4741 cctgcggagg actgtgaccc gcgacccagc tggctggttt ggaaagttgg aacagagttc
     4801 aatactcagg caaatgtatt ggactagggg ccctaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtctttg ctgggcgagg ctgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gctggtcatt gcagagctga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgaggt tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccgc tccatctaat gatggtgcag ccggtcttgt accagaggct aacaatgaga
     5161 ccatggcact tgaaccggtg gctggggctt caatagccgc cccactcacc ggtcaaaaca
     5221 atattataga cccctggatt agattaaatt ttgtgcaggc tcccaatggg gagttcacgg
     5281 tttcaccccg caactcgccc ggggaagtcc tattaaactt ggaattaggc cccgaactaa
     5341 atccatacct agcacacctt tctagaatgt ataatggtta tgcaggtggg gttgaggtgc
     5401 aagtactact ggctgggaat gcgttcacag ctggaaaatt ggtgtttgcc gcagttcccc
     5461 ctcattttcc attagaaaac ataagccctg gccagataac tatgttccct catgtaatta
     5521 ttgatgttag gactttagaa ccagttttgt tgccccttcc agatgttagg aataatttct
     5581 ttcattataa tcagcagaat gaaccgagga tgagactcgt ggcaatgctt tacactcctc
     5641 ttagatctaa tggttctggt gatgatgtat ttactgtctc ctgcagggtg cttacccgac
     5701 cttcccctga ttttgatttt aattacttgg tccctcctac cgttgaatct aaaactaaac
     5761 ccttcacact ccctaccttg actatagggg agttaaccaa ctccaggttc cctgtgccca
     5821 tagatgagct ctacaccagt cccaatgaga gtctggtggt gcaaccccag aatgggagat
     5881 gcgcgctaga tggggagctg cggggcacga ctcagctcct ccccacggcg atttgcccat
     5941 tcaggggccg gatcaatcag aaggtgagtg gagaaaacca tgtttggaat atgcaggtca
     6001 ccaacatcaa cgggacccct tttgatccaa cagaggatgt cccggctccc ctaggcaccc
     6061 cagatttctc tggcaagctc tttggtgtac taagccagag ggaccatgat aatgcctgta
     6121 ggagtcatga tgcagtaatt gcaaccaact ctgccaaatt tactccaaaa ttgggcgcta
     6181 tacaaattgg cacatgggaa gaagacgatg tgcacatcaa ccaacctact aagtttactc
     6241 cagttggctt gtttgaaaat gaaggtttca accagtggac actccccaat tactctggag
     6301 ccttaacact taatatgggg ttggcccctc ctgtggcccc caccttccct ggtgaacgaa
     6361 tccttttctt tagatcccac attcctctta aaggaggtgt ggcggaccca gttattgatt
     6421 gtctcttgca ccaagagtgg atccaacatc tttaccaaga gtcggcccct tcacaatcag
     6481 atgtggcatt gattaggttt acaaatccag acacaggacg tgttctattt gaagcaaaat
     6541 tacacaggag tggttacatt acagtggcca atactggtag cagaccgatt gtggtaccag
     6601 ctaatggtta cttcaggttt gactcttggg ttaatcaatt ctattctctc gcccccatgg
     6661 gaactggaaa tgggcgcaga agggtgcaat aatggctgga gcttttatag cagggcttgc
     6721 tggtgacata gtcaccaatg gcattggctc acttgtgaac gctggggcta atgcaataaa
     6781 tcaaaaagta gactttgaaa ataacaagca actacagcag gcttctttca accatgataa
     6841 agagatgctg caagctcaag tccaggccac caaacagctg caggctgata tgattgcaat
     6901 cagacaaggg gtgttgaccg cgggcggctt ctcccccact gatgcagcaa gaggggcagt
     6961 taatgcacct atgactcagg tcttagactg gaacgggacc aggcattggg cccccggagc
     7021 cacgaaaacc actgctttct ccggtggatt caccaatgct tctcatgccg gaactgtcga
     7081 cctgaccaag aagacatcag ccacaccagc ccctacgtct gtttctagac ctagctctat
     7141 tgcctctaca gtctccaccc gctcaacctt ggttagcggg tctttcaacc cttcttcttc
     7201 agctaggagt tcttctagtg tttcttctca acccacctcc tcctcttctc ggaccagtga
     7261 gtgggtgcgc agccaaaaca gggcactgga gccttacatg aggggagcgc tacacacagc
     7321 ctatgtgacg cctccctcta gtagagcttc tagtaatggc acagtctcaa ccgtgccaaa
     7381 agaggttttg gactcctgga catctgcatt taacacccgc agacaaccgc tattcgctca
     7441 tctccgtcgg agaggggagt cacaagttta gtgaaaagat gatctttatt ttctttcctt
     7501 tgaagattct ttttgtcttt t
//